APEX2 Antibody - BSA Free

Western Blot: APEX2 Antibody [NBP2-84441] - Samples: lane 1-5: U2OS cell lysate, lanes 6 HEK293T cell lysate. Lane 1: non-targeting siRNA control, lane 2: APEX2_5 siRNA, lanes 3: APEX2_6 siRNA, lanes 4: APEX2_7 siRNA, lanes 5: APEX2_8 siRNA. Below: loading control, anti-actin mouse ab 1:5000. Western blot conditions: Cells were pelleted and lysed in RIPA buffer with protease inhibitors. Lysates were centrifuged at 16 000 g for 10 min and 9 ug of lysate was loaded in each lane on a 4-15% SDS-PAGE gel. Samples were transferred on a nitrocellulose membrane and blocked with 1.5% BSA O/N. NBP2-84441 antibody was diluted 1:500 (1 ug/ml) in TBST and incubated for 2 h. IImage from verified customer review.

Western Blot: APEX2 Antibody [NBP2-84441] - Host: Rabbit. Target Name: APEX2. Sample Tissue: Human Testicular Tumor lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

APEX2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human APEX2. Peptide sequence: LMTPKTPEEKAVAKVVKGQAKTSEAKDEKELRTSFWKSVLAGPLRTPLCG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APEX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for APEX2 Antibody - BSA Free

• AP endonuclease 2
• APE2
• APEX nuclease (apurinic/apyrimidinic endonuclease) 2
• APEX nuclease 2
• APEXL2
• Apurinic-apyrimidinic endonuclease 2
• DNA-(apurinic or apyrimidinic site) lyase 2
• DNA-apurinic or apyrimidinic site lyase 2
• EC 3.1
• EC 4.2.99.18
• XTH2

Background

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes a protein shown to have a weak class II AP endonuclease activity. Most of the encoded protein is located in the nucleus but some is also present in mitochondria. This protein may play an important role in both nuclear and mitochondrial base excision repair (BER). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for APEX2 Antibody (NBP2-84441) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 02/05/2022

Summary

• Application: Western Blot
• Sample Tested: HEK293 cell lysate,Lysate from U2OS cells
• Species: Human
• Lot: QC35814-42452

Comments

• Comments: Western blot conditions: Cells were pelleted and lysed in RIPA buffer with protease inhibitors. Lysates were centrifuged at 16 000 g for 10 min and 9 ug of lysate was loaded in each lane on a 4-15% SDS-PAGE gel. Samples were transferred on a nitrocellulose membrane and blocked with 1.5% BSA O/N. NBP2-84441 antibody was diluted 1:500 (1 µg/ml) in TBST and incubated for 2 h.

Bioinformatics

• Gene Symbol: APEX2