APEH Antibody

Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85334] - Staining in human kidney and pancreas tissues using anti-APEH antibody. Corresponding APEH RNA-seq data are presented for the same tissues.

Western Blot: APEH Antibody [NBP1-85334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85334] - Staining of human colon.

Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85334] - Staining of human kidney.

Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85334] - Staining of human pancreas.

Immunohistochemistry-Paraffin: APEH Antibody [NBP1-85334] - Staining of human cerebral cortex.

Simple Western: APEH Antibody [NBP1-85334] - Simple Western lane view shows a specific band for APEH in 0.2 mg/ml of RT4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: APEH Antibody [NBP1-85334] - Electropherogram image of the corresponding Simple Western lane view. APEH antibody was used at 1:25 dilution on RT4 lysate(s) respectively.

Product Discontinued

APEH Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IARLKKPDQAIKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGVPENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRSA
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APEH
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for APEH Antibody

• AARE
• ACPH
• acylamino-acid-releasing enzyme
• acylaminoacyl-peptidase
• Acyl-peptide hydrolase
• APH
• D3F15S2
• D3S48EEC 3.4.19.1
• DNF15S2
• MGC2178
• N-acylaminoacyl-peptide hydrolase
• OPH
• Oxidized protein hydrolase

Background

The APEH gene encodes the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated aminoacid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is furtherprocessed to acetate and a free

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APEH