AP3S1 Antibody


Western Blot: AP3S1 Antibody [NBP1-55449] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Gp, RbSpecies Glossary
Applications WB

Order Details

AP3S1 Antibody Summary

Synthetic peptides corresponding to AP3S1(adaptor-related protein complex 3, sigma 1 subunit) The peptide sequence was selected from the N terminal of AP3S1 (NP_001275). Peptide sequence IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against AP3S1 and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using NBP1-55449.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AP3S1 Antibody

  • Adapter-related protein complex 3 sigma-1 subunit
  • adaptor-related protein complex 3, sigma 1 subunit
  • AP-3 complex sigma-3A subunit
  • AP-3 complex subunit sigma-3A
  • CLAPS3AP-3 complex subunit sigma-1
  • Clathrin-associated/assembly/adapter protein, small 3
  • clathrin-associated/assembly/adaptor protein, small 3 (22kD)
  • Sigma3A
  • sigma-3A-adaptin
  • Sigma3A-adaptin
  • Sigma-adaptin 3a


AP3S1 is part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Bv, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, Flow-IC, KO
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
Species: Hu, Bv, Rb
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Gp, Rb
Applications: WB

Publications for AP3S1 Antibody (NBP1-55449)(1)

Showing Publication 1 - 1 of 1.
Publication using NBP1-55449 Applications Species
Lefrancois,S. Dev. Cell 7 (4), 619-625. 2004 [PMID: 15469849]

Reviews for AP3S1 Antibody (NBP1-55449) (0)

There are no reviews for AP3S1 Antibody (NBP1-55449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP3S1 Antibody (NBP1-55449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional AP3S1 Products

Bioinformatics Tool for AP3S1 Antibody (NBP1-55449)

Discover related pathways, diseases and genes to AP3S1 Antibody (NBP1-55449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP3S1 Antibody (NBP1-55449)

Discover more about diseases related to AP3S1 Antibody (NBP1-55449).

Pathways for AP3S1 Antibody (NBP1-55449)

View related products by pathway.

PTMs for AP3S1 Antibody (NBP1-55449)

Learn more about PTMs related to AP3S1 Antibody (NBP1-55449).

Blogs on AP3S1

There are no specific blogs for AP3S1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AP3S1 Antibody and receive a gift card or discount.


Gene Symbol AP3S1