AP3S1 Antibody

Images

 
Western Blot: AP3S1 Antibody [NBP1-55449] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AP3S1 Antibody Summary

Immunogen
Synthetic peptides corresponding to AP3S1(adaptor-related protein complex 3, sigma 1 subunit) The peptide sequence was selected from the N terminal of AP3S1 (NP_001275). Peptide sequence IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP3S1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against AP3S1 and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-55449.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AP3S1 Antibody

  • Adapter-related protein complex 3 sigma-1 subunit
  • adaptor-related protein complex 3, sigma 1 subunit
  • AP-3 complex sigma-3A subunit
  • AP-3 complex subunit sigma-3A
  • CLAPS3AP-3 complex subunit sigma-1
  • Clathrin-associated/assembly/adapter protein, small 3
  • clathrin-associated/assembly/adaptor protein, small 3 (22kD)
  • Sigma3A
  • sigma-3A-adaptin
  • sigma3A-adaptin
  • Sigma-adaptin 3a

Background

AP3S1 is part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
AF1555
Species: Hu
Applications: WB
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
H00010879-T01
Species: Hu
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-46862
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NBP2-27158
Species: Hu
Applications: WB, IHC-P
NBP1-55449
Species: Hu
Applications: WB

Publications for AP3S1 Antibody (NBP1-55449)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-55449 Applications Species
Lefrancois,S. Dev. Cell 7 (4), 619-625. 2004 [PMID: 15469849]

Reviews for AP3S1 Antibody (NBP1-55449) (0)

There are no reviews for AP3S1 Antibody (NBP1-55449). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP3S1 Antibody (NBP1-55449) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AP3S1 Products

Bioinformatics Tool for AP3S1 Antibody (NBP1-55449)

Discover related pathways, diseases and genes to AP3S1 Antibody (NBP1-55449). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP3S1 Antibody (NBP1-55449)

Discover more about diseases related to AP3S1 Antibody (NBP1-55449).
 

Pathways for AP3S1 Antibody (NBP1-55449)

View related products by pathway.

PTMs for AP3S1 Antibody (NBP1-55449)

Learn more about PTMs related to AP3S1 Antibody (NBP1-55449).

Blogs on AP3S1

There are no specific blogs for AP3S1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP3S1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP3S1
Uniprot