AP3M2 Antibody - BSA Free

Western Blot: AP3M2 Antibody [NBP1-56624] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AP3M2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to AP3M2(adaptor-related protein complex 3, mu 2 subunit) The peptide sequence was selected from the middle region of AP3M2 (NP_006794). Peptide sequence VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: mu-2.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP3M2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AP3M2 Antibody - BSA Free

• Adapter-related protein complex 3 mu-2 subunit
• adaptor-related protein complex 3, mu 2 subunit
• AP-3 complex subunit mu-2
• AP47B
• CLA20
• Clathrin assembly protein assembly protein complex 1 medium chain homolog 2
• Clathrin coat assembly protein AP47 homolog 2
• Clathrin coat-associated protein AP47 homolog 2
• clathrin-associated protein AP47 homolog 2
• Golgi adaptor AP-1 47 kDa protein homolog 2
• HA1 47 kDa subunit homolog 2
• HA1 47kDA subunit homolog 2
• mu3B-adaptin
• P47B

Background

AP3M2 is part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 3 (AP-3), which belongs to the adaptor complexes medium subunits family. The AP-3 complex plays a role in protein trafficking to lysosomes and specialized organelles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AP3M2 Antibody (NBP1-56624)(1)

Publication using NBP1-56624

• Huang,MC. Brain Dev. 29 (8), 462-467. 2007-01-01 [PMID: 17293072]

Bioinformatics

• Gene Symbol: AP3M2
• Entrez:
  • 10947(Human)
• Uniprot:
  • P53677(Human)