AP3M2 Antibody

Images

 
Western Blot: AP3M2 Antibody [NBP1-56624] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AP3M2 Antibody Summary

Immunogen
Synthetic peptides corresponding to AP3M2(adaptor-related protein complex 3, mu 2 subunit) The peptide sequence was selected from the middle region of AP3M2 (NP_006794). Peptide sequence VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID.
Specificity
This product is specific to Subunit or Isoform: mu-2.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP3M2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against AP3M2 and was validated on Western blot.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-56624.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AP3M2 Antibody

  • Adapter-related protein complex 3 mu-2 subunit
  • adaptor-related protein complex 3, mu 2 subunit
  • AP-3 complex subunit mu-2
  • AP47B
  • CLA20
  • Clathrin assembly protein assembly protein complex 1 medium chain homolog 2
  • Clathrin coat assembly protein AP47 homolog 2
  • Clathrin coat-associated protein AP47 homolog 2
  • clathrin-associated protein AP47 homolog 2
  • Golgi adaptor AP-1 47 kDa protein homolog 2
  • HA1 47 kDa subunit homolog 2
  • HA1 47kDA subunit homolog 2
  • mu3B-adaptin
  • P47B

Background

AP3M2 is part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 3 (AP-3), which belongs to the adaptor complexes medium subunits family. The AP-3 complex plays a role in protein trafficking to lysosomes and specialized organelles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57035
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB
NBP2-00834
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-49643
Species: Hu, Mu, Mk
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, Flow-IC, KO
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-65215
Species: Hu
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB500-418
Species: Hu, Po, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RIA, B/N
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, KO

Publications for AP3M2 Antibody (NBP1-56624)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-56624 Applications Species
Huang,MC. Brain Dev. 29 (8), 462-467. 2007 [PMID: 17293072]

Reviews for AP3M2 Antibody (NBP1-56624) (0)

There are no reviews for AP3M2 Antibody (NBP1-56624). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP3M2 Antibody (NBP1-56624) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AP3M2 Products

Bioinformatics Tool for AP3M2 Antibody (NBP1-56624)

Discover related pathways, diseases and genes to AP3M2 Antibody (NBP1-56624). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP3M2 Antibody (NBP1-56624)

Discover more about diseases related to AP3M2 Antibody (NBP1-56624).
 

Pathways for AP3M2 Antibody (NBP1-56624)

View related products by pathway.

PTMs for AP3M2 Antibody (NBP1-56624)

Learn more about PTMs related to AP3M2 Antibody (NBP1-56624).

Blogs on AP3M2

There are no specific blogs for AP3M2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP3M2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP3M2
Entrez
Uniprot