AP1M1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit AP1M1 Antibody - BSA Free (NBP2-92000) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human AP1M1 (NP_115882.1). MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AP1M1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for AP1M1 Antibody - BSA Free
Background
AP1M1, or AP-1 complex subunit mu-1, contains two similarly massed isoforms that are 49 kDa and 50 kDa, and is involved in the binding of clathrin to coated vesicle receptors within the Golgi vesicle. Kaposi's sarcoma, immunodeficiency, neuronitis, and malaria are being used in research along with AP1M1 to determine the relationship between the protein and disease. Pathways including the adaptive immune system, lysosome vesicle biogenesis, and trans-Golgi Network Vesicle Budding are linked to the protein, as are proteins such as HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Xp
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
Publications for AP1M1 Antibody (NBP2-92000) (0)
There are no publications for AP1M1 Antibody (NBP2-92000).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AP1M1 Antibody (NBP2-92000) (0)
There are no reviews for AP1M1 Antibody (NBP2-92000).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AP1M1 Antibody (NBP2-92000) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AP1M1 Products
Research Areas for AP1M1 Antibody (NBP2-92000)
Find related products by research area.
|
Blogs on AP1M1