AP1AR Antibody

Images

 
Western Blot: AP1AR Antibody [NBP1-90879] - Analysis in control (vector only transfected HEK293T lysate) and AP1AR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: AP1AR Antibody [NBP1-90879] - Staining of human placenta shows cytoplasmic positivity in trophoblasts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AP1AR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GNCCWTQCFGLLRKEAGRLQRVGGGGGSKYFRTCSRGEHLTIEFENLVESDEGESPGSSHRPLTEEEIVDLRERHYDSIAE
Specificity
Specificity of human AP1AR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AP1AR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AP1AR Protein (NBP1-90879PEP)
Publications
Read Publication using NBP1-90879.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AP1AR Antibody

  • 2C18
  • adaptor-related protein complex 1 associated regulatory protein
  • gamma-BAR
  • GBAR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-92808
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00004595-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP1-88054
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59786
Species: Hu
Applications: WB
NBP2-67020
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt, V-Vi
Applications: WB, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB100-56530
Species: Hu
Applications: WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P

Publications for AP1AR Antibody (NBP1-90879)(1)

Reviews for AP1AR Antibody (NBP1-90879) (0)

There are no reviews for AP1AR Antibody (NBP1-90879). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP1AR Antibody (NBP1-90879) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AP1AR Products

Bioinformatics Tool for AP1AR Antibody (NBP1-90879)

Discover related pathways, diseases and genes to AP1AR Antibody (NBP1-90879). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for AP1AR Antibody (NBP1-90879)

View related products by pathway.

PTMs for AP1AR Antibody (NBP1-90879)

Learn more about PTMs related to AP1AR Antibody (NBP1-90879).

Blogs on AP1AR

There are no specific blogs for AP1AR, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP1AR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AP1AR
Entrez
Uniprot