Annexin A1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Annexin A1 Antibody [NBP1-90161] - Staining of human cell line U-251 MG shows localization to plasma membrane and cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90161] - Staining of human colon, esophagus, lung and lymph node using Anti-Annexin A1 antibody NBP1-90161 (A) shows similar protein distribution across tissues to independent antibody NBP1-90162 (B).

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90161] - Analysis in human esophagus and cerebral cortex tissues. Corresponding ANXA1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90161] - Staining of human esophagus shows strong positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90161] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90161] - Staining of human colon shows strong positivity in lymphoid cells.

Immunohistochemistry-Paraffin: Annexin A1 Antibody [NBP1-90161] - Staining of human lung shows strong positivity in macrophages.

Staining of human lymph node shows moderate positivity in non-germinal center cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis using antibody NBP1-90161 (A) shows similar pattern to independent antibody NBP1-90162 (B).

Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-PPIB.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Annexin A1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANXA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Annexin A1 Protein (NBP1-90161PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Annexin A1 Antibody - BSA Free

• Annexin A1
• annexin I (lipocortin I)
• Annexin I
• Annexin-1
• ANX1
• ANXA1
• Calpactin II
• calpactin-2
• chromobindin-9
• Lipocortin I
• LPC1
• LPC1annexin-1
• p35
• Phospholipase A2 inhibitory protein

Background

Annexin I, also known as Annexin A1, belongs to the annexin family of calcium dependent phospholipid binding proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANXA1