ANKRD57 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ANKRD57 Antibody [NBP2-49215] - Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ANKRD57 Antibody [NBP2-49215] - Staining in human esophagus and lymph node tissues using anti-SOWAHC antibody. Corresponding SOWAHC RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: ANKRD57 Antibody [NBP2-49215] - Staining of human skin shows cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: ANKRD57 Antibody [NBP2-49215] - Staining of human esophagus shows high expression.
Immunohistochemistry-Paraffin: ANKRD57 Antibody [NBP2-49215] - Staining of human lymph node shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ANKRD57 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EAVLRFLAERGGRALHAELVQHFRGALGGEPEQRARARAHFKELVNAVATVRVDPADGAKYVHLKKRFCEGPSEPSGDPPRIQVTA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOWAHC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANKRD57 Recombinant Protein Antigen (NBP2-49215PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD57 Antibody

  • ankyrin repeat domain 57
  • ankyrin repeat domain-containing protein 57
  • C2orf26
  • FLJ21870

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Bv, Ca, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
DSE100
Species: Hu
Applications: ELISA
MAB6731
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
NB100-368
Species: Hu, Mu
Applications: WB
NBP2-20145
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-30475
Species: Hu
Applications: IHC, IHC-P, IP
MAB6166
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-76566
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
H00065009-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-81796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-98301
Species: Hu
Applications: WB
NBP2-37485
Species: Hu, Pm, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-17058
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80736
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33202
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-01872
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ANKRD57 Antibody (NBP2-49215) (0)

There are no publications for ANKRD57 Antibody (NBP2-49215).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD57 Antibody (NBP2-49215) (0)

There are no reviews for ANKRD57 Antibody (NBP2-49215). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ANKRD57 Antibody (NBP2-49215) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD57 Products

Bioinformatics Tool for ANKRD57 Antibody (NBP2-49215)

Discover related pathways, diseases and genes to ANKRD57 Antibody (NBP2-49215). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ANKRD57

There are no specific blogs for ANKRD57, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD57 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOWAHC