ANKRD57 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ANKRD57 Antibody [NBP2-49215] - Immunofluorescent staining of human cell line PC-3 shows localization to cytosol.

Immunohistochemistry-Paraffin: ANKRD57 Antibody [NBP2-49215] - Staining in human esophagus and lymph node tissues using anti-SOWAHC antibody. Corresponding SOWAHC RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ANKRD57 Antibody [NBP2-49215] - Staining of human skin shows cytoplasmic positivity in epidermal cells.

Immunohistochemistry-Paraffin: ANKRD57 Antibody [NBP2-49215] - Staining of human esophagus shows high expression.

Immunohistochemistry-Paraffin: ANKRD57 Antibody [NBP2-49215] - Staining of human lymph node shows low expression as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ANKRD57 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ANKRD57 Antibody - BSA Free (NBP2-49215) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EAVLRFLAERGGRALHAELVQHFRGALGGEPEQRARARAHFKELVNAVATVRVDPADGAKYVHLKKRFCEGPSEPSGDPPRIQVTA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SOWAHC
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ANKRD57 Recombinant Protein Antigen (NBP2-49215PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ANKRD57 Antibody - BSA Free

• ankyrin repeat domain 57
• ankyrin repeat domain-containing protein 57
• C2orf26
• FLJ21870

Background

ANKRD57 is an ankyrin repeat containing protein whose function has not been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SOWAHC