ANKRD17 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ANKRD17 Antibody [NBP2-57107] - Staining of human cell line RH-30 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD17 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KEIDELIPKNRLKSSSANSKIGSSAPTTTAANTSLMGIKMTTVALSSTSQTATALTVPAISSASTHKTIKNPVNNVRPGFPVSLP
Specificity
Specificity of human ANKRD17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD17
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANKRD17 Recombinant Protein Antigen (NBP2-57107PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ANKRD17 Antibody

  • ankyrin repeat domain 17
  • ankyrin repeat domain-containing protein 17
  • Gene trap ankyrin repeat protein
  • GTARSerologically defined breast cancer antigen NY-BR-16
  • KIAA0697FLJ22206
  • NY-BR-16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-61849
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-91867
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
H00404734-R01
Species: Hu

Publications for ANKRD17 Antibody (NBP2-57107) (0)

There are no publications for ANKRD17 Antibody (NBP2-57107).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD17 Antibody (NBP2-57107) (0)

There are no reviews for ANKRD17 Antibody (NBP2-57107). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ANKRD17 Antibody (NBP2-57107) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ANKRD17 Antibody (NBP2-57107)

Discover related pathways, diseases and genes to ANKRD17 Antibody (NBP2-57107). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD17 Antibody (NBP2-57107)

Discover more about diseases related to ANKRD17 Antibody (NBP2-57107).
 

Pathways for ANKRD17 Antibody (NBP2-57107)

View related products by pathway.

PTMs for ANKRD17 Antibody (NBP2-57107)

Learn more about PTMs related to ANKRD17 Antibody (NBP2-57107).

Blogs on ANKRD17

There are no specific blogs for ANKRD17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD17