ANKRD11 Antibody

Western Blot: ANKRD11 Antibody [NBP1-52984] - Titration: 1.25ug/ml Positive Control: Human Placenta.

Immunohistochemistry-Paraffin: ANKRD11 Antibody [NBP1-52984] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ANKRD11 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ANKRD11 (ankyrin repeat domain 11) The peptide sequence was selected from the N terminal of ANKRD11 (NP_037407). Peptide sequence: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRD11
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 4-8 ug/ml
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against ANKRD11 and was validated on Western Blot and immunohistochemistry-P
• Theoretical MW: 298 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ANKRD11 Antibody

• ANCO-1
• ANCO1ankyrin repeat domain-containing protein 11
• ankyrin repeat domain 11
• Ankyrin repeat-containing cofactor 1
• ankyrin repeat-containing protein 11
• LZ16
• nasopharyngeal carcinoma susceptibility protein
• T13

Background

ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKRD11
• Entrez:
  • 29123(Human)
• Uniprot:
  • Q6UB99(Human)