ANKRD11 Antibody


Western Blot: ANKRD11 Antibody [NBP1-52984] - Titration: 1.25ug/ml Positive Control: Human Placenta.
Immunohistochemistry-Paraffin: ANKRD11 Antibody [NBP1-52984] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ANKRD11 Antibody Summary

Synthetic peptides corresponding to ANKRD11 (ankyrin repeat domain 11) The peptide sequence was selected from the N terminal of ANKRD11 (NP_037407). Peptide sequence: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.25 ug/ml
  • Immunohistochemistry 4-8 ug/ml
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ANKRD11 and was validated on Western Blot and immunohistochemistry-P
Theoretical MW
298 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ANKRD11 Antibody

  • ANCO-1
  • ANCO1ankyrin repeat domain-containing protein 11
  • ankyrin repeat domain 11
  • Ankyrin repeat-containing cofactor 1
  • ankyrin repeat-containing protein 11
  • LZ16
  • nasopharyngeal carcinoma susceptibility protein
  • T13


ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, B/N, Flow, IHC, IHC-Fr
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ANKRD11 Antibody (NBP1-52984) (0)

There are no publications for ANKRD11 Antibody (NBP1-52984).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD11 Antibody (NBP1-52984) (0)

There are no reviews for ANKRD11 Antibody (NBP1-52984). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ANKRD11 Antibody (NBP1-52984) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ANKRD11 Products

Bioinformatics Tool for ANKRD11 Antibody (NBP1-52984)

Discover related pathways, diseases and genes to ANKRD11 Antibody (NBP1-52984). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD11 Antibody (NBP1-52984)

Discover more about diseases related to ANKRD11 Antibody (NBP1-52984).

Pathways for ANKRD11 Antibody (NBP1-52984)

View related products by pathway.

PTMs for ANKRD11 Antibody (NBP1-52984)

Learn more about PTMs related to ANKRD11 Antibody (NBP1-52984).

Blogs on ANKRD11

There are no specific blogs for ANKRD11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ANKRD11 Antibody and receive a gift card or discount.


Gene Symbol ANKRD11