ANKRD1 Antibody [DyLight 405]

Product Discontinued

ANKRD1 Antibody [DyLight 405] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human ANKRD1 (NP_055206.2).
  
  Sequence:
  MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for ANKRD1 Antibody [DyLight 405]

• ALRP
• ankyrin repeat domain 1 (cardiac muscle)
• ankyrin repeat domain-containing protein 1
• bA320F15.2
• C193
• C-193
• Cardiac ankyrin repeat protein
• CARPCytokine-inducible nuclear protein
• CVARP
• Cytokine-inducible gene C-193 protein
• HA1A2
• liver ankyrin repeat domain 1
• MCARP

Background

ANKRD1 is encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKRD1