ANKRD1 Antibody


Immunocytochemistry/ Immunofluorescence: ANKRD1 Antibody [NBP2-14292] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
Immunohistochemistry-Paraffin: ANKRD1 Antibody [NBP2-14292] - Staining in human heart muscle and testis tissues. Corresponding ANKRD1 RNA-seq data are presented for the same tissues.
Immunohistochemistry: ANKRD1 Antibody [NBP2-14292] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: ANKRD1 Antibody [NBP2-14292] - Staining of human heart shows moderate cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: ANKRD1 Antibody [NBP2-14292] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ANKRD1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RYKMIRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKT SRIATF
Specificity of human ANKRD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANKRD1 Protein (NBP2-14292PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ANKRD1 Antibody

  • ALRP
  • ankyrin repeat domain 1 (cardiac muscle)
  • ankyrin repeat domain-containing protein 1
  • bA320F15.2
  • C193
  • C-193
  • Cardiac ankyrin repeat protein
  • CARPCytokine-inducible nuclear protein
  • Cytokine-inducible gene C-193 protein
  • HA1A2
  • liver ankyrin repeat domain 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P

Publications for ANKRD1 Antibody (NBP2-14292) (0)

There are no publications for ANKRD1 Antibody (NBP2-14292).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD1 Antibody (NBP2-14292) (0)

There are no reviews for ANKRD1 Antibody (NBP2-14292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ANKRD1 Antibody (NBP2-14292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ANKRD1 Antibody (NBP2-14292)

Discover related pathways, diseases and genes to ANKRD1 Antibody (NBP2-14292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD1 Antibody (NBP2-14292)

Discover more about diseases related to ANKRD1 Antibody (NBP2-14292).

Pathways for ANKRD1 Antibody (NBP2-14292)

View related products by pathway.

PTMs for ANKRD1 Antibody (NBP2-14292)

Learn more about PTMs related to ANKRD1 Antibody (NBP2-14292).

Blogs on ANKRD1

There are no specific blogs for ANKRD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ANKRD1 Antibody and receive a gift card or discount.


Gene Symbol ANKRD1