ANKRD1 Antibody

Immunohistochemistry-Paraffin: ANKRD1 Antibody [NBP2-14292] - Staining in human heart muscle and testis tissues . Corresponding ANKRD1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: ANKRD1 Antibody [NBP2-14292] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ANKRD1 Antibody [NBP2-14292] - Staining of human heart shows moderate cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: ANKRD1 Antibody [NBP2-14292] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Product Discontinued

ANKRD1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RYKMIRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ANKRD1 Antibody

• ALRP
• ankyrin repeat domain 1 (cardiac muscle)
• ankyrin repeat domain-containing protein 1
• bA320F15.2
• C193
• C-193
• Cardiac ankyrin repeat protein
• CARPCytokine-inducible nuclear protein
• CVARP
• Cytokine-inducible gene C-193 protein
• HA1A2
• liver ankyrin repeat domain 1
• MCARP

Background

ANKRD1 is encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKRD1
• Entrez:
  • 27063(Human)
• Uniprot:
  • Q15327(Human)