ANKRD1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ANKRD1 Antibody [NBP2-14292] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
Immunohistochemistry: ANKRD1 Antibody [NBP2-14292] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RYKMIRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKT SRIATF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANKRD1 Protein (NBP2-14292PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD1 Antibody

  • ALRP
  • ankyrin repeat domain 1 (cardiac muscle)
  • ankyrin repeat domain-containing protein 1
  • bA320F15.2
  • C193
  • C-193
  • Cardiac ankyrin repeat protein
  • CARPCytokine-inducible nuclear protein
  • CVARP
  • Cytokine-inducible gene C-193 protein
  • HA1A2
  • liver ankyrin repeat domain 1
  • MCARP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-14510
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-91669
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ANKRD1 Antibody (NBP2-14292) (0)

There are no publications for ANKRD1 Antibody (NBP2-14292).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD1 Antibody (NBP2-14292) (0)

There are no reviews for ANKRD1 Antibody (NBP2-14292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ANKRD1 Antibody (NBP2-14292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD1 Products

Bioinformatics Tool for ANKRD1 Antibody (NBP2-14292)

Discover related pathways, diseases and genes to ANKRD1 Antibody (NBP2-14292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKRD1 Antibody (NBP2-14292)

Discover more about diseases related to ANKRD1 Antibody (NBP2-14292).
 

Pathways for ANKRD1 Antibody (NBP2-14292)

View related products by pathway.

PTMs for ANKRD1 Antibody (NBP2-14292)

Learn more about PTMs related to ANKRD1 Antibody (NBP2-14292).

Blogs on ANKRD1

There are no specific blogs for ANKRD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD1
Entrez
Uniprot