ANKHD1 Antibody

Images

 
Immunohistochemistry-Paraffin: ANKHD1 Antibody [NBP1-84650] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKHD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKHD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ANKHD1 Protein (NBP1-84650PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKHD1 Antibody

  • ankyrin repeat and KH domain containing 1
  • FLJ10042
  • FLJ11979
  • FLJ14127
  • hMASK
  • KIAA1085single KH-domain homolog
  • MASKFLJ20288
  • Multiple ankyrin repeats single KH domain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2485
Species: Hu
Applications: WB, IHC, IP
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF842
Species: Hu
Applications: WB
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84650
Species: Hu
Applications: IHC, IHC-P

Publications for ANKHD1 Antibody (NBP1-84650) (0)

There are no publications for ANKHD1 Antibody (NBP1-84650).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKHD1 Antibody (NBP1-84650) (0)

There are no reviews for ANKHD1 Antibody (NBP1-84650). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ANKHD1 Antibody (NBP1-84650) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKHD1 Products

Bioinformatics Tool for ANKHD1 Antibody (NBP1-84650)

Discover related pathways, diseases and genes to ANKHD1 Antibody (NBP1-84650). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ANKHD1 Antibody (NBP1-84650)

Discover more about diseases related to ANKHD1 Antibody (NBP1-84650).
 

Pathways for ANKHD1 Antibody (NBP1-84650)

View related products by pathway.

Blogs on ANKHD1

There are no specific blogs for ANKHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKHD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKHD1
Entrez
Uniprot