Angiopoietin-like Protein 2/ANGPTL2 Antibody

Images

 
Immunohistochemistry-Paraffin: Angiopoietin-like Protein 2/ANGPTL2 Antibody [NBP1-88997] - Staining of human stomach, upper shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Angiopoietin-like Protein 2/ANGPTL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQQRVTGAICVNSKEPEVLLENRVHKQELELLNNELLKQKRQIE
Specificity
Specificity of human Angiopoietin-like Protein 2/ANGPTL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANGPTL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Angiopoietin-like Protein 2/ANGPTL2 Protein (NBP1-88997PEP)
Publications
Read Publication using NBP1-88997.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Angiopoietin-like Protein 2/ANGPTL2 Antibody

  • angiopoietin-like 2
  • Angiopoietin-like Protein 2
  • angiopoietin-related protein 2
  • ANGPTL2
  • ANGRP2
  • ARP2HARP
  • MGC8889

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-996
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-75395
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-82512
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF5514
Species: Hu, Mu
Applications: WB
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-88999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00555
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NBP1-90099
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89226
Species: Hu
Applications: IHC, IHC-P
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-19188
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86859
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Angiopoietin-like Protein 2/ANGPTL2 Antibody (NBP1-88997)(1)

Reviews for Angiopoietin-like Protein 2/ANGPTL2 Antibody (NBP1-88997) (0)

There are no reviews for Angiopoietin-like Protein 2/ANGPTL2 Antibody (NBP1-88997). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Angiopoietin-like Protein 2/ANGPTL2 Antibody (NBP1-88997) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Angiopoietin-like Protein 2/ANGPTL2 Products

Bioinformatics Tool for Angiopoietin-like Protein 2/ANGPTL2 Antibody (NBP1-88997)

Discover related pathways, diseases and genes to Angiopoietin-like Protein 2/ANGPTL2 Antibody (NBP1-88997). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Angiopoietin-like Protein 2/ANGPTL2 Antibody (NBP1-88997)

Discover more about diseases related to Angiopoietin-like Protein 2/ANGPTL2 Antibody (NBP1-88997).
 

Pathways for Angiopoietin-like Protein 2/ANGPTL2 Antibody (NBP1-88997)

View related products by pathway.

PTMs for Angiopoietin-like Protein 2/ANGPTL2 Antibody (NBP1-88997)

Learn more about PTMs related to Angiopoietin-like Protein 2/ANGPTL2 Antibody (NBP1-88997).

Blogs on Angiopoietin-like Protein 2/ANGPTL2

There are no specific blogs for Angiopoietin-like Protein 2/ANGPTL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Angiopoietin-like Protein 2/ANGPTL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANGPTL2
Entrez
Uniprot