ANAPC13 Antibody - BSA Free

Western Blot: ANAPC13 Antibody [NBP1-91664] - Analysis in control (vector only transfected HEK293T lysate) and ANAPC13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: ANAPC13 Antibody [NBP1-91664] - Staining of human cell line U-2 OS shows positivity in mitochondria.

Immunohistochemistry-Paraffin: ANAPC13 Antibody [NBP1-91664] - Staining of human kidney shows cytoplasmic positivity in renal tubules.

Analysis in control (vector only transfected HEK293T lysate) and ANAPC13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ANAPC13 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ANAPC13 Antibody - BSA Free (NBP1-91664) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVP
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANAPC13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ANAPC13 Protein (NBP1-91664PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ANAPC13 Antibody - BSA Free

• anaphase promoting complex subunit 13
• anaphase-promoting complex subunit 13
• APC13SWM1
• cyclosome subunit 13
• Cylosome subunit 13
• DKFZP566D193
• homolog of yeast Swm1

Background

ANAPC13 encodes a component of the anaphase promoting complex, a large ubiquitin-protein ligase that controls cell cycle progression by regulating the degradation of cell cycle regulators such as B-type cyclins. The encoded protein is evolutionarily conserved and is required for the integrity and ubiquitin ligase activity of the anaphase promoting complex. Pseudogenes and splice variants have been found for this gene; however, the biological validity of some of the splice variants has not been determined. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the functional protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANAPC13
• Entrez:
  • 25847(Human)
• Uniprot:
  • Q9BS18(Human)