
Western Blot: AMSH/STAMBP Antibody [NBP1-90172] - Lane 1: Marker (kDa) 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: AMSH/STAMBP Antibody [NBP1-90172] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: AMSH/STAMBP Antibody [NBP1-90172] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

AMSH/STAMBP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: QQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQP
Specificity of human AMSH/STAMBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
AMSH/STAMBP Protein (NBP1-90172PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for AMSH/STAMBP Antibody

  • AMSH
  • AMSHAssociated molecule with the SH3 domain of STAM
  • EC
  • EC 3.4.19.-
  • Endosome-associated ubiquitin isopeptidase
  • MGC126516
  • MGC126518
  • STAM binding protein
  • STAM-binding protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AMSH/STAMBP Antibody (NBP1-90172) (0)

There are no publications for AMSH/STAMBP Antibody (NBP1-90172).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMSH/STAMBP Antibody (NBP1-90172) (0)

There are no reviews for AMSH/STAMBP Antibody (NBP1-90172). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AMSH/STAMBP Antibody (NBP1-90172) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional AMSH/STAMBP Products

Bioinformatics Tool for AMSH/STAMBP Antibody (NBP1-90172)

Discover related pathways, diseases and genes to AMSH/STAMBP Antibody (NBP1-90172). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMSH/STAMBP Antibody (NBP1-90172)

Discover more about diseases related to AMSH/STAMBP Antibody (NBP1-90172).

Pathways for AMSH/STAMBP Antibody (NBP1-90172)

View related products by pathway.

PTMs for AMSH/STAMBP Antibody (NBP1-90172)

Learn more about PTMs related to AMSH/STAMBP Antibody (NBP1-90172).

Research Areas for AMSH/STAMBP Antibody (NBP1-90172)

Find related products by research area.


There are no specific blogs for AMSH/STAMBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AMSH/STAMBP Antibody and receive a gift card or discount.


Gene Symbol STAMBP