AMPD2 Antibody - BSA Free

Western Blot: AMPD2 Antibody [NBP2-48578] - Analysis in human cell line RT-4, human cell line U-251 MG and human plasma.

Immunohistochemistry: AMPD2 Antibody [NBP2-48578] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.

Product Discontinued

AMPD2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSADAP
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AMPD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AMPD2 Antibody - BSA Free

• adenosine monophosphate deaminase 2 (isoform L)
• adenosine monophosphate deaminase 2
• AMP deaminase 2
• AMP deaminase isoform L
• AMPD
• EC 3.5.4.6

Background

Adenosine monophosphate deaminase-2 (EC 3.5.4.6) catalyzes the deamination of AMP to IMP and plays an important role inthe purine nucleotide cycle.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AMPD2