AMPD2 Antibody (2F5)

Images

 
Western Blot: AMPD2 Antibody (2F5) [H00000271-M01A] - AMPD2 monoclonal antibody (M01A), clone 2F5. Analysis of AMPD2 expression in NIH/3T3.
Western Blot: AMPD2 Antibody (2F5) [H00000271-M01A] - AMPD2 monoclonal antibody (M01A), clone 2F5. Analysis of AMPD2 expression in PC-12.
Western Blot: AMPD2 Antibody (2F5) [H00000271-M01A] - AMPD2 monoclonal antibody (M01A), clone 2F5 Analysis of AMPD2 expression in Hela S3 NE.
Western Blot: AMPD2 Antibody (2F5) [H00000271-M01A] - AMPD2 monoclonal antibody (M01A), clone 2F5. Analysis of AMPD2 expression in Raw 264.7.
Western Blot: AMPD2 Antibody (2F5) [H00000271-M01A] - Analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M01A), clone 2F5.Lane 1: AMPD2 transfected lysate(92.1 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, SqSpecies Glossary
Applications WB, ELISA
Clone
2F5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AMPD2 Antibody (2F5) Summary

Immunogen
AMPD2 (NP_631895, 86 a.a. - 185 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
Specificity
AMPD2 - adenosine monophosphate deaminase 2 (isoform L) (2F5)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AMPD2
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Control
AMPD2 Knockout 293T Cell Lysate
Publications
Read Publications using
H00000271-M01A in the following applications:

  • WB
    2 publications

Reactivity Notes

Squirrel reactivity reported in scientific literature (PMID: 25856396). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Ascites
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AMPD2 Antibody (2F5)

  • adenosine monophosphate deaminase 2 (isoform L)
  • adenosine monophosphate deaminase 2
  • AMP deaminase 2
  • AMP deaminase isoform L
  • AMPD
  • EC 3.5.4.6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Op, Pm
Applications: WB, IHC-P
NBP2-49690
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-14290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82541
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1905
Species: Mu
Applications: WB
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37245
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, Flow-IC
AF9024
Species: Mu, Rt
Applications: WB, IHC

Publications for AMPD2 Antibody (H00000271-M01A)(2)

We have publications tested in 2 confirmed species: Rat, Squirrel.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Rat
(1)
Squirrel
(1)
All Species

Reviews for AMPD2 Antibody (H00000271-M01A) (0)

There are no reviews for AMPD2 Antibody (H00000271-M01A). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMPD2 Antibody (H00000271-M01A) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional AMPD2 Products

Bioinformatics Tool for AMPD2 Antibody (H00000271-M01A)

Discover related pathways, diseases and genes to AMPD2 Antibody (H00000271-M01A). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMPD2 Antibody (H00000271-M01A)

Discover more about diseases related to AMPD2 Antibody (H00000271-M01A).
 

Pathways for AMPD2 Antibody (H00000271-M01A)

View related products by pathway.

PTMs for AMPD2 Antibody (H00000271-M01A)

Learn more about PTMs related to AMPD2 Antibody (H00000271-M01A).

Blogs on AMPD2

There are no specific blogs for AMPD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMPD2 Antibody (2F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol AMPD2
Entrez
Uniprot