Amisyn Antibody

Images

 
Western Blot: Amisyn Antibody [NBP1-90175] - Analysis in human cell lines Caco-2 and PC-3 using Anti-STXBP6 antibody. Corresponding STXBP6 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: Amisyn Antibody [NBP1-90175] - Staining of human lateral ventricle shows strong positivity in neuronal cells.
Western Blot: Amisyn Antibody [NBP1-90175] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

Amisyn Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NKKPTQASITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNGDSAEFDLLFENAFDQWVASTASEKCTFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERLGRAEEKTEDLK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STXBP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Amisyn Protein (NBP1-90175PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Amisyn Antibody

  • amisyn
  • FLJ39638
  • HSPC156
  • syntaxin binding protein 6 (amisyn)
  • syntaxin-binding protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-56176
Species: Hu
Applications: ICC/IF
NBP1-03414
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85626
Species: Hu
Applications: IHC, IHC-P
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00055254-P01
Species: Hu
AF5117
Species: Hu
Applications: WB, IHC
NBP1-90003
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24495
Species: Hu, Pm
Applications: WB, ICC/IF
NBP1-85574
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13792
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82689
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13284
Species: Hu
Applications: WB, IHC, IHC-P
AF5249
Species: Hu
Applications: WB

Publications for Amisyn Antibody (NBP1-90175) (0)

There are no publications for Amisyn Antibody (NBP1-90175).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Amisyn Antibody (NBP1-90175) (0)

There are no reviews for Amisyn Antibody (NBP1-90175). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Amisyn Antibody (NBP1-90175) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Amisyn Products

Bioinformatics Tool for Amisyn Antibody (NBP1-90175)

Discover related pathways, diseases and genes to Amisyn Antibody (NBP1-90175). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Amisyn Antibody (NBP1-90175)

Discover more about diseases related to Amisyn Antibody (NBP1-90175).
 

Pathways for Amisyn Antibody (NBP1-90175)

View related products by pathway.

PTMs for Amisyn Antibody (NBP1-90175)

Learn more about PTMs related to Amisyn Antibody (NBP1-90175).

Blogs on Amisyn

There are no specific blogs for Amisyn, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Amisyn Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STXBP6