TMEM39A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TMEM39A Antibody [NBP1-83813] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: TMEM39A Antibody [NBP1-83813] - Staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM39A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HQDSRAHLLLTDYNYVVQHEAVEESASTVGGLAKSKDFLSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM39A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM39A Protein (NBP1-83813PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM39A Antibody

  • FLJ10902
  • transmembrane protein 39A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5117
Species: Hu
Applications: WB, IHC
NBP1-82689
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24495
Species: Hu, Pm
Applications: WB, ICC/IF
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
H00338662-R02
Species: Hu
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90175
Species: Hu
Applications: WB, IHC, IHC-P
MAB4247
Species: Hu
Applications: WB, IP
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1717
Species: Hu
Applications: WB, IP
4290-S4
Species: Hu
NBP1-93803
Species: Hu
Applications: IHC, IHC-P
NBP1-56394
Species: Hu
Applications: WB
AF641
Species: Mu
Applications: WB, IHC
NBP1-84188
Species: Hu
Applications: IHC, IHC-P

Publications for TMEM39A Antibody (NBP1-83813) (0)

There are no publications for TMEM39A Antibody (NBP1-83813).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM39A Antibody (NBP1-83813) (0)

There are no reviews for TMEM39A Antibody (NBP1-83813). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TMEM39A Antibody (NBP1-83813) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM39A Products

TMEM39A NBP1-83813

Bioinformatics Tool for TMEM39A Antibody (NBP1-83813)

Discover related pathways, diseases and genes to TMEM39A Antibody (NBP1-83813). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM39A Antibody (NBP1-83813)

Discover more about diseases related to TMEM39A Antibody (NBP1-83813).

Blogs on TMEM39A

There are no specific blogs for TMEM39A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM39A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM39A