![Immunocytochemistry/Immunofluorescence: TMEM39A Antibody [NBP1-83813] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.](http://images.novusbio.com/fullsize/TMEM39A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83813-img0008.jpg "Immunocytochemistry/Immunofluorescence: TMEM39A Antibody [NBP1-83813] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HQDSRAHLLLTDYNYVVQHEAVEESASTVGGLAKSKDFLSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIK |
| Predicted Species | Mouse (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMEM39A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![ADAMTSL-1/Punctin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ADAMTSL-1/Punctin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMEM39A |
![Immunohistochemistry-Paraffin: TMEM39A Antibody [NBP1-83813] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/TMEM39A-Antibody-Immunohistochemistry-Paraffin-NBP1-83813-img0011.jpg "Immunohistochemistry-Paraffin: TMEM39A Antibody [NBP1-83813] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: TMEM39A Antibody [NBP1-83813] - Staining of human fallopian tube shows moderate to strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TMEM39A-Antibody-Immunohistochemistry-Paraffin-NBP1-83813-img0009.jpg "Immunohistochemistry-Paraffin: TMEM39A Antibody [NBP1-83813] - Staining of human fallopian tube shows moderate to strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TMEM39A Antibody [NBP1-83813] - Staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TMEM39A-Antibody-Immunohistochemistry-Paraffin-NBP1-83813-img0010.jpg "Immunohistochemistry-Paraffin: TMEM39A Antibody [NBP1-83813] - Staining of human rectum shows moderate to strong cytoplasmic positivity in glandular cells.")
![Western Blot Ikaros/IKZF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ikaros_AF4984_Western_Blot_5594.jpg)
![Chromatin Immunoprecipitation (ChIP) Ikaros/IKZF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ikaros_AF4984_Chromatin_Immunoprecipitation_11241.jpg)
![Simple Western Ikaros/IKZF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ikaros_AF4984_Simple_Western_16946.jpg)
![SDS-PAGE IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_403.jpg)
![Bioactivity IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_405.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")