Aminopeptidase O/ONPEP Antibody

Images

 
Western Blot: aminopeptidase O Antibody [NBP1-89066] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: aminopeptidase O Antibody [NBP1-89066] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aminopeptidase O/ONPEP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ECSSWYYYVTMPMPASTFTIAVGCWTEMKMETWSSNDLATERPFSPSEANFRHVGVCSHMEYPCRFQNASATTQEIIPHRVFAPVCLTGACQETLLRLIPPCLSAAHSVLGAHPFSRLDVLIVPANFPSLGMA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C9ORF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
94 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Aminopeptidase O/ONPEP Protein (NBP1-89066PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aminopeptidase O/ONPEP Antibody

  • Aminopeptidase O
  • AOPEP
  • APO
  • AP-OFLJ55832
  • C90RF3
  • C9orf3
  • chromosome 9 open reading frame 3
  • EC 3.4.11.-
  • FLJ14675
  • FLJ40923
  • ONPEP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-27348
Species: Hu
Applications: WB
NB600-610
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for Aminopeptidase O/ONPEP Antibody (NBP1-89066) (0)

There are no publications for Aminopeptidase O/ONPEP Antibody (NBP1-89066).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminopeptidase O/ONPEP Antibody (NBP1-89066) (0)

There are no reviews for Aminopeptidase O/ONPEP Antibody (NBP1-89066). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aminopeptidase O/ONPEP Antibody (NBP1-89066) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aminopeptidase O/ONPEP Products

Bioinformatics Tool for Aminopeptidase O/ONPEP Antibody (NBP1-89066)

Discover related pathways, diseases and genes to Aminopeptidase O/ONPEP Antibody (NBP1-89066). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for Aminopeptidase O/ONPEP Antibody (NBP1-89066)

View related products by pathway.

PTMs for Aminopeptidase O/ONPEP Antibody (NBP1-89066)

Learn more about PTMs related to Aminopeptidase O/ONPEP Antibody (NBP1-89066).

Blogs on Aminopeptidase O/ONPEP

There are no specific blogs for Aminopeptidase O/ONPEP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aminopeptidase O/ONPEP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C9ORF3
Entrez
Uniprot