Aminopeptidase B/RNPEP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Aminopeptidase B/RNPEP Antibody [NBP2-54975] - Staining of human cell line U-2 OS shows localization to nucleoplasm & the Golgi apparatus.

Immunohistochemistry-Paraffin: Aminopeptidase B/RNPEP Antibody [NBP2-54975] - Immunohistochemical staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.

Western Blot: Aminopeptidase B/RNPEP Antibody [NBP2-54975] -Analysis in human cell line SK-BR-3.

Immunohistochemistry-Paraffin: Aminopeptidase B/RNPEP Antibody [NBP2-54975] -Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Aminopeptidase B/RNPEP Antibody [NBP2-54975]- Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Aminopeptidase B/RNPEP Antibody [NBP2-54975] -Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Aminopeptidase B/RNPEP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Aminopeptidase B/RNPEP Antibody - BSA Free (NBP2-54975) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MKPAEELAQLWAAEELDMKAIEAVAISPWKTYQLVYFLDKILQKSPLPPGNVKKLGDTYPSISNARNAELRLRWGQI
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNPEP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Aminopeptidase B/RNPEP Recombinant Protein Antigen (NBP2-54975PEP)

Reactivity Notes

Mouse 87%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Aminopeptidase B/RNPEP Antibody - BSA Free

• Aminopeptidase B
• APB
• AP-B
• Arginine aminopeptidase
• arginyl aminopeptidase (aminopeptidase B)
• Arginyl Aminopeptidase
• DKFZp547H084
• EC 3.4.11
• EC 3.4.11.6
• RNPEP

Background

Exopeptidase which selectively removes arginine and/or lysine residues from the N-terminus of several peptide substrates including Arg(0)-Leu-enkephalin, Arg(0)-Met-enkephalin and Arg(-1)-Lys(0)-somatostatin-14. Can hydrolyze leukotriene A4 (LTA-4) into leukotriene B4 (LTB-4)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNPEP