AMIGO Antibody

Images

 
Western Blot: AMIGO Antibody [NBP2-14287] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: AMIGO Antibody [NBP2-14287] - Staining of human cell line BJ shows localization to nucleoplasm & nuclear bodies.
Immunohistochemistry-Paraffin: AMIGO Antibody [NBP2-14287] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AMIGO Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCD TKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMIGO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AMIGO Protein (NBP2-14287PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AMIGO Antibody

  • adhesion molecule with Ig-like domain 1
  • ali2
  • Alivin-2
  • AMIGO
  • AMIGO1
  • AMIGO-1
  • AMIGOamphoterin-induced protein 1
  • amphoterin-induced gene and ORF
  • KIAA1163

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4899
Species: Hu
Applications: IHC
MAB2374
Species: Hu, Mu
Applications: WB
AF1440
Species: Mu
Applications: WB
MAB2375
Species: Mu
Applications: WB, IHC
AF3086
Species: Hu
Applications: WB, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3086
Species: Hu
Applications: WB, IHC
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP2-45912
Species: Hu
Applications: WB, IHC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
H00025878-R04
Species: Hu
AF163
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-77086
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-14287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AMIGO Antibody (NBP2-14287) (0)

There are no publications for AMIGO Antibody (NBP2-14287).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMIGO Antibody (NBP2-14287) (0)

There are no reviews for AMIGO Antibody (NBP2-14287). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AMIGO Antibody (NBP2-14287) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMIGO Products

Bioinformatics Tool for AMIGO Antibody (NBP2-14287)

Discover related pathways, diseases and genes to AMIGO Antibody (NBP2-14287). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMIGO Antibody (NBP2-14287)

Discover more about diseases related to AMIGO Antibody (NBP2-14287).
 

Pathways for AMIGO Antibody (NBP2-14287)

View related products by pathway.

PTMs for AMIGO Antibody (NBP2-14287)

Learn more about PTMs related to AMIGO Antibody (NBP2-14287).

Blogs on AMIGO

There are no specific blogs for AMIGO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMIGO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMIGO1
Entrez
Uniprot