Recombinant Human ALPK2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ALPK2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 201-309 of Human ALPK2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFASDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKRGSRKSARVRQPGMKGNP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ALPK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALPK2 GST (N-Term) Protein

  • alpha-kinase 2
  • EC 2.7.11.-
  • FLJ34875
  • FLJ43253
  • HAKalpha-protein kinase 2
  • heart alpha-kinase
  • Heart alpha-protein kinase

Background

ALPK2 - alpha-kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
8475-OM/CF
Species: Hu
Applications: BA
NBP2-45788
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-83594
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP2-75518
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
DY7847-05
Species: Hu
Applications: ELISA
NBP2-31583
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
H00057538-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
1129-ER
Species: Hu
Applications: BA
NBP1-88792
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-97510
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
641-A4
Species: Mu
Applications: Bind
NBP1-72115
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00008814-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00115701-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ALPK2 Partial Recombinant Protein (H00115701-Q01) (0)

There are no publications for ALPK2 Partial Recombinant Protein (H00115701-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALPK2 Partial Recombinant Protein (H00115701-Q01) (0)

There are no reviews for ALPK2 Partial Recombinant Protein (H00115701-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALPK2 Partial Recombinant Protein (H00115701-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ALPK2 Products

Array H00115701-Q01

Bioinformatics Tool for ALPK2 Partial Recombinant Protein (H00115701-Q01)

Discover related pathways, diseases and genes to ALPK2 Partial Recombinant Protein (H00115701-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALPK2 Partial Recombinant Protein (H00115701-Q01)

Discover more about diseases related to ALPK2 Partial Recombinant Protein (H00115701-Q01).
 

Pathways for ALPK2 Partial Recombinant Protein (H00115701-Q01)

View related products by pathway.

PTMs for ALPK2 Partial Recombinant Protein (H00115701-Q01)

Learn more about PTMs related to ALPK2 Partial Recombinant Protein (H00115701-Q01).
 

Research Areas for ALPK2 Partial Recombinant Protein (H00115701-Q01)

Find related products by research area.

Blogs on ALPK2

There are no specific blogs for ALPK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALPK2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALPK2