Recombinant Human ALPK2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ALPK2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 201 - 309 of Human ALPK2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFASDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKRGSRKSARVRQPGMKGNP

Protein/Peptide Type
Partial Recombinant Protein
Gene
ALPK2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALPK2 Protein

  • alpha-kinase 2
  • EC 2.7.11.-
  • FLJ34875
  • FLJ43253
  • HAKalpha-protein kinase 2
  • heart alpha-kinase
  • Heart alpha-protein kinase

Background

ALPK2 - alpha-kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1360
Species: Mu
Applications: WB, IHC
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
NBP2-31583
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00057538-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
AF641
Species: Mu
Applications: WB, IHC
NBP2-33469
Species: Hu
Applications: IHC, IHC-P
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ALPK2 Partial Recombinant Protein (H00115701-Q01) (0)

There are no publications for ALPK2 Partial Recombinant Protein (H00115701-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALPK2 Partial Recombinant Protein (H00115701-Q01) (0)

There are no reviews for ALPK2 Partial Recombinant Protein (H00115701-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALPK2 Partial Recombinant Protein (H00115701-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALPK2 Products

Bioinformatics Tool for ALPK2 Partial Recombinant Protein (H00115701-Q01)

Discover related pathways, diseases and genes to ALPK2 Partial Recombinant Protein (H00115701-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALPK2 Partial Recombinant Protein (H00115701-Q01)

Discover more about diseases related to ALPK2 Partial Recombinant Protein (H00115701-Q01).
 

Pathways for ALPK2 Partial Recombinant Protein (H00115701-Q01)

View related products by pathway.

PTMs for ALPK2 Partial Recombinant Protein (H00115701-Q01)

Learn more about PTMs related to ALPK2 Partial Recombinant Protein (H00115701-Q01).
 

Research Areas for ALPK2 Partial Recombinant Protein (H00115701-Q01)

Find related products by research area.

Blogs on ALPK2

There are no specific blogs for ALPK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ALPK2 Antibody
NBP1-83295

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALPK2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALPK2