alpha-Sarcoglycan Antibody

Images

 
Western Blot: alpha Sarcoglycan Antibody [NBP1-90306] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: alpha Sarcoglycan Antibody [NBP1-90306] - Staining of human heart muscle shows distinct positivity of intercalated discs in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alpha-Sarcoglycan Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SGCA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
alpha-Sarcoglycan Protein (NBP1-90306PEP)
Publications
Read Publication using NBP1-90306.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alpha-Sarcoglycan Antibody

  • 50-DAG
  • Adhalin
  • ADL
  • alphaSarcoglycan
  • alpha-Sarcoglycan
  • DAG2
  • DMDA2
  • DMDA250kD DAG
  • Dystroglycan-2
  • LGMD2D
  • LGMD2Dalpha (50kD dystrophin-associated glycoprotein)
  • sarcoglycan, alpha (50kDa dystrophin-associated glycoprotein)
  • SCARMD1
  • SGCA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89330
Species: Hu
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-62539
Species: Hu
Applications: WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for alpha-Sarcoglycan Antibody (NBP1-90306)(1)

Reviews for alpha-Sarcoglycan Antibody (NBP1-90306) (0)

There are no reviews for alpha-Sarcoglycan Antibody (NBP1-90306). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha-Sarcoglycan Antibody (NBP1-90306) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha-Sarcoglycan Products

Bioinformatics Tool for alpha-Sarcoglycan Antibody (NBP1-90306)

Discover related pathways, diseases and genes to alpha-Sarcoglycan Antibody (NBP1-90306). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha-Sarcoglycan Antibody (NBP1-90306)

Discover more about diseases related to alpha-Sarcoglycan Antibody (NBP1-90306).
 

Pathways for alpha-Sarcoglycan Antibody (NBP1-90306)

View related products by pathway.

PTMs for alpha-Sarcoglycan Antibody (NBP1-90306)

Learn more about PTMs related to alpha-Sarcoglycan Antibody (NBP1-90306).

Blogs on alpha-Sarcoglycan

There are no specific blogs for alpha-Sarcoglycan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha-Sarcoglycan Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SGCA
Entrez
Uniprot