Alpha-parvin/Actopaxin Antibody

Images

 
Western Blot: Alpha-parvin/Actopaxin Antibody [NBP1-87912] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Alpha-parvin/Actopaxin Antibody [NBP1-87912] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol, actin filaments & focal adhesion sites.
Immunohistochemistry-Paraffin: Alpha-parvin/Actopaxin Antibody [NBP1-87912] - Staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Alpha-parvin/Actopaxin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARVA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Alpha-parvin/Actopaxin Protein (NBP1-87912PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Alpha-parvin/Actopaxin Antibody

  • Actopaxin
  • alphaParvin
  • alpha-Parvin
  • Calponin-like integrin-linked kinase-binding protein
  • CH-ILKBP
  • FLJ10793
  • FLJ12254
  • FLJ25106
  • FLJ46049
  • Matrix-remodeling-associated protein 2
  • matrix-remodelling associated 2
  • MXRA2
  • PARVA
  • parvin, alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
MAB6257
Species: Hu, Mu, Rt
Applications: WB
NBP2-46327
Species: Hu
Applications: WB, IHC
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31713
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00064098-M01
Species: Hu
Applications: WB, ELISA, IP
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr

Publications for Alpha-parvin/Actopaxin Antibody (NBP1-87912) (0)

There are no publications for Alpha-parvin/Actopaxin Antibody (NBP1-87912).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alpha-parvin/Actopaxin Antibody (NBP1-87912) (0)

There are no reviews for Alpha-parvin/Actopaxin Antibody (NBP1-87912). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Alpha-parvin/Actopaxin Antibody (NBP1-87912) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Alpha-parvin/Actopaxin Products

Bioinformatics Tool for Alpha-parvin/Actopaxin Antibody (NBP1-87912)

Discover related pathways, diseases and genes to Alpha-parvin/Actopaxin Antibody (NBP1-87912). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha-parvin/Actopaxin Antibody (NBP1-87912)

Discover more about diseases related to Alpha-parvin/Actopaxin Antibody (NBP1-87912).
 

Pathways for Alpha-parvin/Actopaxin Antibody (NBP1-87912)

View related products by pathway.

PTMs for Alpha-parvin/Actopaxin Antibody (NBP1-87912)

Learn more about PTMs related to Alpha-parvin/Actopaxin Antibody (NBP1-87912).

Blogs on Alpha-parvin/Actopaxin

There are no specific blogs for Alpha-parvin/Actopaxin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Alpha-parvin/Actopaxin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARVA
Entrez
Uniprot