beta COP Antibody

Images

 
Western Blot: beta COP Antibody [NBP2-39027] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: beta COP Antibody [NBP2-39027] - Immunofluorescent staining of human cell line RH-30 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: beta COP Antibody [NBP2-39027] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

beta COP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKT
Specificity
Specificity of human beta COP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COPB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
beta COP Protein (NBP2-39027PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for beta COP Antibody

  • beta coat protein
  • Beta-coat protein
  • beta-cop
  • coatomer protein complex, subunit beta 1
  • coatomer protein complex, subunit beta
  • coatomer subunit beta
  • COPBFLJ57957
  • DKFZp761K102
  • FLJ10341
  • FLJ46444

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-72296
Species: Hu
NBP1-31480
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58286
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55178
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF

Publications for beta COP Antibody (NBP2-39027) (0)

There are no publications for beta COP Antibody (NBP2-39027).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for beta COP Antibody (NBP2-39027) (0)

There are no reviews for beta COP Antibody (NBP2-39027). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for beta COP Antibody (NBP2-39027) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for beta COP Antibody (NBP2-39027)

Discover related pathways, diseases and genes to beta COP Antibody (NBP2-39027). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for beta COP Antibody (NBP2-39027)

Discover more about diseases related to beta COP Antibody (NBP2-39027).
 

Pathways for beta COP Antibody (NBP2-39027)

View related products by pathway.

Blogs on beta COP

There are no specific blogs for beta COP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our beta COP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COPB1
Uniprot