Independent Antibodies: Western Blot: COPG Antibody [NBP2-55178] - Analysis using Anti-COPG1 antibody NBP2-55178 (A) shows similar pattern to independent antibody NBP1-85514 (B).
Immunocytochemistry/ Immunofluorescence: COPG Antibody [NBP2-55178] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: COPG Antibody [NBP2-55178] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Novus Biologicals Rabbit COPG Antibody - BSA Free (NBP2-55178) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-COPG Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COPG1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for COPG Antibody - BSA Free
coat protein gamma-cop
coatomer protein complex, subunit gamma 1
coatomer protein complex, subunit gamma
COPG1coatomer subunit gamma
FLJ21068
Gamma-coat protein
gamma-COP
Background
The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our COPG Antibody - BSA Free and receive a gift card or discount.