We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NRBF2 Antibody - BSA Free

Images

 
Western Blot: NRBF2 Antibody [NBP3-38273] - Western blot analysis of lysates from HepG2 cells, using [KO Validated] NRBF2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) ...read more
Western Blot: NRBF2 Antibody [NBP3-38273] - Western blot analysis of various lysates using NRBF2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] - Immunofluorescence analysis of L929 cells using [KO Validated] NRBF2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat ...read more
Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] - Immunofluorescence analysis of C6 cells using [KO Validated] NRBF2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat ...read more
Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] - Immunofluorescence analysis of C6 cells using NRBF2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit ...read more
Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] - Immunofluorescence analysis of HeLa cells using NRBF2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat ...read more
Immunohistochemistry: NRBF2 Antibody [NBP3-38273] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using [KO Validated] NRBF2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval ...read more
Immunocytochemistry/ Immunofluorescence: NRBF2 Antibody [NBP3-38273] - Immunofluorescence analysis of C6 cells using NRBF2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit ...read more
Immunohistochemistry: NRBF2 Antibody [NBP3-38273] - Immunohistochemistry analysis of paraffin-embedded Human esophageal using [KO Validated] NRBF2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval ...read more
Western Blot: NRBF2 Antibody [NBP3-38273] - Western Blot analysis of various lysates using NRBF2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

NRBF2 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-287 of human NRBF2 (NP_110386.2).

Sequence:
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRBF2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for NRBF2 Antibody - BSA Free

  • Comodulator of PPAR and RXR
  • COPR
  • COPR1
  • COPR2
  • DKFZp564C1664
  • FLJ30395
  • NRBF-2
  • nuclear receptor binding factor 2
  • nuclear receptor binding factor-2
  • nuclear receptor-binding factor 2

Background

NRBF2 (nuclear receptor binding factor-2) was originally identified in a yeast two-hybrid screen for factors that interact with the peroxisome proliferator-activated receptor alpha (PPARalpha). In a second study, NRBF2 was also identified in a screen of a keratinocyte cDNA library and named COPR (comodulator of PPAR and RXR). In this study, NRBF2 was proposed to function as a modulator of transcriptional activity that functions to decrease rather than completely repress nuclear-receptor mediated gene expression. Alternative names for NRBF2 include COPR1, COPR2, and NRBF-2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, ISH, WB
NBP1-83790
Species: Hu
Applications: IHC,  IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-30884
Species: Hu
Applications: IHC,  IHC-P
NBP1-89705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-5802
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP3-46820
Species: Hu
Applications: ELISA, IHC, WB
NBP2-45516
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
DTSP10
Applications: ELISA
H00340371-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for NRBF2 Antibody (NBP3-38273) (0)

There are no publications for NRBF2 Antibody (NBP3-38273).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRBF2 Antibody (NBP3-38273) (0)

There are no reviews for NRBF2 Antibody (NBP3-38273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NRBF2 Antibody (NBP3-38273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NRBF2 Products

Research Areas for NRBF2 Antibody (NBP3-38273)

Find related products by research area.

Blogs on NRBF2

There are no specific blogs for NRBF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRBF2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NRBF2