alpha COP I Antibody (3W6Y6)

Western Blot: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Western blot analysis of extracts of various cell lines, using alpha COP I Rabbit mAb (NBP3-15839) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Western blot analysis of extracts of Rat brain, using alpha COP I Rabbit mAb (NBP3-15839) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Immunohistochemistry analysis of alpha COP I in paraffin-embedded human thyroid cancer tissue using alpha COP I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Immunohistochemistry analysis of alpha COP I in paraffin-embedded human colon tissue using alpha COP I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Immunohistochemistry analysis of alpha COP I in paraffin-embedded human colon carcinoma tissue using alpha COP I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Immunohistochemistry analysis of alpha COP I in paraffin-embedded mouse brain tissue using alpha COP I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Immunohistochemistry analysis of alpha COP I in paraffin-embedded rat colon tissue using alpha COP I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: alpha COP I Antibody (3W6Y6) [NBP3-15839] - Immunohistochemistry analysis of alpha COP I in paraffin-embedded mouse testis tissue using alpha COP I Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 3W6Y6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

alpha COP I Antibody (3W6Y6) Summary

• Description: Novus Biologicals Rabbit alpha COP I Antibody (3W6Y6) (NBP3-15839) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human alpha COP I (P53621). MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTF
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: COPA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for alpha COP I Antibody (3W6Y6)

• alpha coat protein
• Alpha-coat protein
• Alpha-COP
• coatomer protein complex, subunit alpha
• coatomer subunit alpha
• FLJ26320
• HEPCOP
• HEP-COPalpha-COP
• xenin

Background

Coatomer proteins are involved in regulating transport between the endoplasmic reticulum (ER) and the Golgi complex and in intra-Golgi transport. There exist two coatomer-protein mechanisms (COP I and COP II) and although they have mechanistic parallels, they are molecularly distinct. The COP I coat is comprised of seven subunits (alpha-, beta-, beta'-, gamma-, delta-, epsilon-, and zeta-COP) in a complex called coatomer. Assembly of the coatomer (COP I) onto non-clathrin coated vesicles is regulated by ADP-ribosylation factor (ARF). Vesicle formation, budding, fusion, and disassembly is dependent on GDP-GTP exchange, COP I, and ARF. COP I has been shown to facilitate retrograde intracellular transport from the ER to the Golgi complex. By contrast, COPII facilitates anterograde transport between these subcellular organelles. COP II has been shown to be independently and selectively recruited to the ER relative to COP I subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COPA