alpha Adaptin Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit alpha Adaptin Antibody - BSA Free (NBP2-92798) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human AP2A1 (NP_055018.2). MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVCKLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDLASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASPDLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSASTDLQDYTYYFVPAPWLSVK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
AP2A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for alpha Adaptin Antibody - BSA Free
Background
AP2A1, also known as AP-2 complex subunit alpha-1, contains a 208 kDa and a 105 kDa isoform, and is involved in protein transport, vesicle formation, and clathrin-dependent endocytosis. Current research is being conducted on the relationship between AP2A1 and a variety of diseases and disorders, including seminoma, neuronitis, Huntington's disease, malaria, myeloid leukemia, carcinoma, gout, immunodeficiency, pancreatic cancer, prostatitis, prostate carcinoma, cholesterol, breast cancer, leukemia, and pancreatitis. AP2A1 is associated with Clathrin-dependent protein traffic, CTLA4 Signaling, p38 Signaling, the EGFR1 Signaling Pathway, the Synaptic Vesicle Pathway, the Arf1 pathway, and L1CAM interactions. The protein interacts with HIP1, TOE1, SMAD9, NUMB, and GRB2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IP, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: Block, IHC, WB
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Publications for alpha Adaptin Antibody (NBP2-92798) (0)
There are no publications for alpha Adaptin Antibody (NBP2-92798).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for alpha Adaptin Antibody (NBP2-92798) (0)
There are no reviews for alpha Adaptin Antibody (NBP2-92798).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for alpha Adaptin Antibody (NBP2-92798) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional alpha Adaptin Products
Research Areas for alpha Adaptin Antibody (NBP2-92798)
Find related products by research area.
|
Blogs on alpha Adaptin