Alpha Actinin 3 Antibody (4H7E6)

Western Blot: Alpha Actinin 3 Antibody (4H7E6) [NBP3-15827] - Western blot analysis of extracts of various cell lines, using Alpha Actinin 3 Rabbit mAb (NBP3-15827) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: Alpha Actinin 3 Antibody (4H7E6) [NBP3-15827] - Immunofluorescence analysis of mouse bone marrow cells using Alpha Actinin 3 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Alpha Actinin 3 Antibody (4H7E6) [NBP3-15827] - Immunofluorescence analysis of rat bone marrow cells using Alpha Actinin 3 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 4H7E6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Alpha Actinin 3 Antibody (4H7E6) Summary

• Description: Novus Biologicals Rabbit Alpha Actinin 3 Antibody (4H7E6) (NBP3-15827) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human Alpha Actinin 3 (Q08043). DRLEGDHQLLQESLVFDNKHTVYSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKQNGMMEPDDFRACLISMGYDLGEVE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ACTN3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Alpha Actinin 3 Antibody (4H7E6)

• actinin, alpha 3
• Alpha-actinin skeletal muscle isoform 3
• alpha-actinin skeletal muscle
• alpha-actinin-3
• F-actin cross-linking protein
• MGC117002
• MGC117005

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACTN3