Alpha Actinin 2 Antibody

Images

 
Western Blot: Alpha Actinin 2 Antibody [NBP1-80254] - Human Muscle lysate, concentration 0.625ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Alpha Actinin 2 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human ACTN2. Peptide sequence IQSYSIRISSSNPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHAN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTN2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ACTN2 and was validated on Western blot.
Theoretical MW
98 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Alpha Actinin 2 Antibody

  • actinin, alpha 2
  • Alpha-actinin skeletal muscle isoform 2
  • alpha-actinin skeletal muscle
  • alpha-actinin-2
  • CMD1AA
  • F-actin cross-linking protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15356
Species: Hu, Mu, Rt
Applications: WB, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NBP1-85544
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-48251
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP1-87851
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80254
Species: Hu, Mu
Applications: WB

Publications for Alpha Actinin 2 Antibody (NBP1-80254) (0)

There are no publications for Alpha Actinin 2 Antibody (NBP1-80254).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alpha Actinin 2 Antibody (NBP1-80254) (0)

There are no reviews for Alpha Actinin 2 Antibody (NBP1-80254). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Alpha Actinin 2 Antibody (NBP1-80254) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Alpha Actinin 2 Products

Bioinformatics Tool for Alpha Actinin 2 Antibody (NBP1-80254)

Discover related pathways, diseases and genes to Alpha Actinin 2 Antibody (NBP1-80254). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alpha Actinin 2 Antibody (NBP1-80254)

Discover more about diseases related to Alpha Actinin 2 Antibody (NBP1-80254).
 

Pathways for Alpha Actinin 2 Antibody (NBP1-80254)

View related products by pathway.

PTMs for Alpha Actinin 2 Antibody (NBP1-80254)

Learn more about PTMs related to Alpha Actinin 2 Antibody (NBP1-80254).

Blogs on Alpha Actinin 2

There are no specific blogs for Alpha Actinin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Alpha Actinin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTN2
Uniprot