alpha 1-Microglobulin Antibody

Images

 
Western Blot: Alpha-1-Microglobulin Antibody [NBP1-87958] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Alpha-1-Microglobulin Antibody [NBP1-87958] - Staining of human bronchus shows cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alpha 1-Microglobulin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
alpha 1-Microglobulin Protein (NBP1-87958PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alpha 1-Microglobulin Antibody

  • A1M
  • alpha 1Microglobulin
  • alpha 1-Microglobulin
  • alpha-1-microglobulin/bikunin precursor
  • AMBP
  • bikunin
  • EDC1
  • HCP
  • HCPcomplex-forming glycoprotein heterogeneous in charge
  • HI30
  • IATIL
  • inter-alpha-trypsin inhibitor light chain
  • ITI
  • ITIL
  • ITILC
  • ITILgrowth-inhibiting protein 19
  • protein AMBP
  • protein HC
  • trypstatin
  • uristatin
  • uronic-acid-rich protein
  • UTI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87958
Species: Hu
Applications: WB, IHC, IHC-P

Publications for alpha 1-Microglobulin Antibody (NBP1-87958) (0)

There are no publications for alpha 1-Microglobulin Antibody (NBP1-87958).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha 1-Microglobulin Antibody (NBP1-87958) (0)

There are no reviews for alpha 1-Microglobulin Antibody (NBP1-87958). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha 1-Microglobulin Antibody (NBP1-87958) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha 1-Microglobulin Products

Bioinformatics Tool for alpha 1-Microglobulin Antibody (NBP1-87958)

Discover related pathways, diseases and genes to alpha 1-Microglobulin Antibody (NBP1-87958). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha 1-Microglobulin Antibody (NBP1-87958)

Discover more about diseases related to alpha 1-Microglobulin Antibody (NBP1-87958).
 

Pathways for alpha 1-Microglobulin Antibody (NBP1-87958)

View related products by pathway.

PTMs for alpha 1-Microglobulin Antibody (NBP1-87958)

Learn more about PTMs related to alpha 1-Microglobulin Antibody (NBP1-87958).

Blogs on alpha 1-Microglobulin

There are no specific blogs for alpha 1-Microglobulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha 1-Microglobulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMBP
Entrez
Uniprot