ALKBH8 Antibody

Images

 
Western Blot: ALKBH8 Antibody [NBP1-80474] - Jurkat cell lysate, concentration 1.0ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALKBH8 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ALKBH8. Peptide sequence EEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALKBH8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ALKBH8 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ALKBH8 Antibody

  • ABH8MGC10235
  • AlkB homologue 8
  • alkB, alkylation repair homolog 8 (E. coli)
  • alkylated DNA repair protein alkB homolog 8
  • EC 1.14.11.-
  • EC 2.1.1.-
  • FLJ38204
  • Probable alpha-ketoglutarate-dependent dioxygenase ABH8
  • S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14283
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-76276
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-31546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-14737
Species: Hu
Applications: IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-80474
Species: Hu
Applications: WB

Publications for ALKBH8 Antibody (NBP1-80474) (0)

There are no publications for ALKBH8 Antibody (NBP1-80474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALKBH8 Antibody (NBP1-80474) (0)

There are no reviews for ALKBH8 Antibody (NBP1-80474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALKBH8 Antibody (NBP1-80474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALKBH8 Products

Bioinformatics Tool for ALKBH8 Antibody (NBP1-80474)

Discover related pathways, diseases and genes to ALKBH8 Antibody (NBP1-80474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALKBH8 Antibody (NBP1-80474)

Discover more about diseases related to ALKBH8 Antibody (NBP1-80474).
 

Pathways for ALKBH8 Antibody (NBP1-80474)

View related products by pathway.

PTMs for ALKBH8 Antibody (NBP1-80474)

Learn more about PTMs related to ALKBH8 Antibody (NBP1-80474).

Blogs on ALKBH8

There are no specific blogs for ALKBH8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALKBH8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALKBH8
Uniprot