ALKBH4 Antibody

Images

 
Immunohistochemistry-Paraffin: ALKBH4 Antibody [NBP2-14737] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALKBH4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLM DRDPWKLSQSGRRKQDYGPKVN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALKBH4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For IF, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
ALKBH4 Protein (NBP2-14737PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALKBH4 Antibody

  • ABH4
  • ALKBH4 alkB, alkylation repair homolog 4 (E. coli)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83711
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76276
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-84274
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69654
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38450
Species: Hu
Applications: WB, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NB110-80070
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-81238
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ALKBH4 Antibody (NBP2-14737) (0)

There are no publications for ALKBH4 Antibody (NBP2-14737).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALKBH4 Antibody (NBP2-14737) (0)

There are no reviews for ALKBH4 Antibody (NBP2-14737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ALKBH4 Antibody (NBP2-14737) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALKBH4 Products

ALKBH4 NBP2-14737

Bioinformatics Tool for ALKBH4 Antibody (NBP2-14737)

Discover related pathways, diseases and genes to ALKBH4 Antibody (NBP2-14737). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ALKBH4 Antibody (NBP2-14737)

View related products by pathway.

PTMs for ALKBH4 Antibody (NBP2-14737)

Learn more about PTMs related to ALKBH4 Antibody (NBP2-14737).

Blogs on ALKBH4

There are no specific blogs for ALKBH4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALKBH4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALKBH4
Entrez
Uniprot