Alkaline Phosphatase, Intestinal Antibody (3A8)

Western Blot: Alkaline Phosphatase, Intestinal Antibody (3A8) [H00000248-M03] - Analysis of ALPI expression in HeLa (Cat # L013V1).

ELISA: Alkaline Phosphatase, Intestinal Antibody (3A8) [H00000248-M03] - Detection limit for recombinant GST tagged ALPI is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3A8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Alkaline Phosphatase, Intestinal Antibody (3A8) Summary

• Immunogen: ALPI (NP_001622, 74 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSV
• Specificity: ALPI - alkaline phosphatase, intestinal
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ALPI
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Alkaline Phosphatase, Intestinal Antibody (3A8)

• alkaline phosphatase, intestinal
• Alkaline phosphomonoesterase
• ALPI
• EC 3.1.3.1
• Glycerophosphatase
• IAP
• Intestinal alkaline phosphatase
• intestinal-type alkaline phosphatase
• Kasahara isozyme

Background

There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is upregulated during small intestinal epithelial cell differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Alkaline Phosphatase, Intestinal Antibody (H00000248-M03)(5)

Publications using H00000248-M03

• Okada K, Kawao N, Tatsumi K et al. Roles of plasminogen in the alterations in bone marrow hematopoietic stem cells during bone repair. Bone Rep 2018-04-27 [PMID: 29955638]
• Yang B, Cao L, Liu J et al. Low expression of chloride channel accessory 1 predicts a poor prognosis in colorectal cancer Cancer. 2015-01-20 [PMID: 25603912] (WB, Human)
• Cao L, McCaig CD, Scott RH et al. Polarizing intestinal epithelial cells electrically through Ror2. J. Cell. Sci. 2014-06-13 [PMID: 24928904] (WB, Human)
  
  Details:
  Antibody used for WB detection of Intestinal alkaline phosphatase (ALPI, a differentiation marker) in C2BBe1 cells which is a subclone of Caco-2 human adenocarcinoma cell line and Ror2WT as well as Ror2 mutant transfectants of C2BBe1 cells (Figures 2 G, H; 3A, E; 4C, E, F, G).
• Yang B, Cao L, Liu B et al. The Transition from Proliferation to Differentiation in Colorectal Cancer Is Regulated by the Calcium Activated Chloride Channel A1. PLoS One 2013-04-12 [PMID: 23593331] (WB, Human)
• Lechner C, Reichel V, Moenning U et al. Development of a fluorescence-based assay for drug interactions with human Multidrug Resistance Related Protein (MRP2; ABCC2) in MDCKII-MRP2 membrane vesicles. Eur J Pharm Biopharm. 2010-03-20 [PMID: 20307659]

Bioinformatics

• Gene Symbol: ALPI
• Entrez:
  • 248(Human)
• OMIM:
  • 171740(Human)
• Uniprot:
  • NP_001622(Human)