Alkaline Phosphatase/ALPP Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Alkaline Phosphatase/ALPP Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALPP.
  
  

  Source: E. coli

  Amino Acid Sequence: NWYSDADVPASARQEGCQDIATQLISNMDI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ALPP
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34056.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Alkaline Phosphatase/ALPP Recombinant Protein Antigen

• Alkaline phosphatase Regan isozyme
• Alkaline Phosphatase
• alkaline phosphatase, placental (Regan isozyme)
• alkaline phosphatase, placental type
• alkaline phosphatase, placental
• alkaline phosphomonoesterase
• ALP
• ALPP
• EC 3.1.3.1
• FLJ61142
• glycerophosphatase
• PALP
• Placental alkaline phosphatase 1
• PLAP
• PLAP-1
• Regan isozyme
• SEAP

Background

Alkaline phosphatases are phosphodiesterases. The placental-specific isozyme of Alkaline Phosphatase (PLAP) is found in trophoblast cells of normal human mature placenta, seminomas of testis and ovarian carcinomas. Detection of alkaline phosphatase in serum is a marker for ovarian and testicular cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for Alkaline Phosphatase/ALPP Protein (NBP2-34056PEP). (Showing 1 - 1 of 1 FAQ).

1. I am looking to use a placental alkaline phosphatase antibody for sorting syncytiotrophoblast material from female tissue. It looks like most people who use these antibodies use in-house versions and references for commercially available antibodies I've found are from the '80's. I noticed you have several different monoclonal antibodies and was hoping you could give me a little more information on them and potential applications they've been tested for. Also, do you have a biotinylated or fluorophore-conjugated version?
   • None of our placental alkaline phosphatase antibodies are biotinylated or fluorchrome conjugated but we offer a number of kits for this application and our lab can do a custom conjugation as well, for an additional fee. NB600-750 is useful in FACS with human cells, so I would recommend this antibody for your experiment. We back the use of this antibody as stated on the datasheet with the 100% Novus Guarantee. If you have questions about another antibody, I will be happy to answer them.

Bioinformatics

• Gene Symbol: ALPP