Alkaline Phosphatase/ALPP Recombinant Protein Antigen

Images

 
There are currently no images for Alkaline Phosphatase/ALPP Protein (NBP2-34056PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Alkaline Phosphatase/ALPP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALPP.

Source: E. coli

Amino Acid Sequence: NWYSDADVPASARQEGCQDIATQLISNMDI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALPP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34056.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Alkaline Phosphatase/ALPP Recombinant Protein Antigen

  • Alkaline phosphatase Regan isozyme
  • Alkaline Phosphatase
  • alkaline phosphatase, placental (Regan isozyme)
  • alkaline phosphatase, placental type
  • alkaline phosphatase, placental
  • alkaline phosphomonoesterase
  • ALP
  • ALPP
  • EC 3.1.3.1
  • FLJ61142
  • glycerophosphatase
  • PALP
  • Placental alkaline phosphatase 1
  • PLAP
  • PLAP-1
  • Regan isozyme
  • SEAP

Background

Alkaline phosphatases are phosphodiesterases. The placental-specific isozyme of Alkaline Phosphatase (PLAP) is found in trophoblast cells of normal human mature placenta, seminomas of testis and ovarian carcinomas. Detection of alkaline phosphatase in serum is a marker for ovarian and testicular cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
MAB7665
Species: Hu
Applications: IHC, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
4014-SP
Species: Hu
Applications: BA
355-BM
Species: Hu, Mu, Rt
Applications: BA
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
DY805
Species: Hu
Applications: ELISA
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, PLA, WB
MAB7547
Species: Hu
Applications: ICC, WB
NBP2-34056PEP
Species: Hu
Applications: AC

Publications for Alkaline Phosphatase/ALPP Protein (NBP2-34056PEP) (0)

There are no publications for Alkaline Phosphatase/ALPP Protein (NBP2-34056PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alkaline Phosphatase/ALPP Protein (NBP2-34056PEP) (0)

There are no reviews for Alkaline Phosphatase/ALPP Protein (NBP2-34056PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Alkaline Phosphatase/ALPP Protein (NBP2-34056PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to use a placental alkaline phosphatase antibody for sorting syncytiotrophoblast material from female tissue. It looks like most people who use these antibodies use in-house versions and references for commercially available antibodies I've found are from the '80's. I noticed you have several different monoclonal antibodies and was hoping you could give me a little more information on them and potential applications they've been tested for. Also, do you have a biotinylated or fluorophore-conjugated version?
    • None of our placental alkaline phosphatase antibodies are biotinylated or fluorchrome conjugated but we offer a number of kits for this application and our lab can do a custom conjugation as well, for an additional fee. NB600-750 is useful in FACS with human cells, so I would recommend this antibody for your experiment. We back the use of this antibody as stated on the datasheet with the 100% Novus Guarantee. If you have questions about another antibody, I will be happy to answer them.

Additional Alkaline Phosphatase/ALPP Products

Research Areas for Alkaline Phosphatase/ALPP Protein (NBP2-34056PEP)

Find related products by research area.

Blogs on Alkaline Phosphatase/ALPP

There are no specific blogs for Alkaline Phosphatase/ALPP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Alkaline Phosphatase/ALPP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ALPP