ALK/CD246 Recombinant Protein Antigen

Images

 
There are currently no images for ALK/CD246 Recombinant Protein Antigen (NBP2-48518PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ALK/CD246 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALK/CD246.

Source: E. coli

Amino Acid Sequence: IFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48518.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ALK/CD246 Recombinant Protein Antigen

  • ALK tyrosine kinase receptor
  • ALK
  • anaplastic lymphoma kinase (Ki-1)
  • Anaplastic lymphoma kinase
  • anaplastic lymphoma receptor tyrosine kinase
  • CD246 antigen
  • CD246
  • EC 2.7.10.1
  • Ki-1
  • NBLST3
  • Tcrz

Background

ALK is a novel receptor protein-tyrosine kinase having a putative transmembrane domain and an extracellular domain. The 2;5 chromosomal translocation occurs in most anaplastic large-cell non-Hodgkin's lymphomas arising from activated T lymphocytes. This rearrangement was shown to fuse the NPM nucleolar phosphoprotein gene on chromosome 5q35 to a previously unidentified protein tyrosine kinase gene, ALK, on chromosome 2p23 (1). In the predicted hybrid protein, the amino terminus of NPM is linked to the catalytic domain of ALK. Immunoblotting with anti-ALK antibody shows that ALK is highly expressed in the neonatal brain (2). Also expressed in the small intestine, testis, and brain but not in normal lymphoid cells, ALK shows greatest sequence similarity to the insulin receptor subfamily of kinases. Unscheduled expression of the truncated ALK may contribute to malignant transformation in these lymphomas (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-46157
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-57586
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC, IHC-P, KD, WB
NB100-56161
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB300-576
Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00007178-M06
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-86805
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF370
Species: Hu
Applications: IP, WB
AF3025
Species: Hu
Applications: ELISA, ICC, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
AF-252-PB
Species: Hu
Applications: IHC, WB
DPI00
Species: Hu
Applications: ELISA
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF276
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-48518PEP
Species: Hu
Applications: AC

Publications for ALK/CD246 Recombinant Protein Antigen (NBP2-48518PEP) (0)

There are no publications for ALK/CD246 Recombinant Protein Antigen (NBP2-48518PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALK/CD246 Recombinant Protein Antigen (NBP2-48518PEP) (0)

There are no reviews for ALK/CD246 Recombinant Protein Antigen (NBP2-48518PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ALK/CD246 Recombinant Protein Antigen (NBP2-48518PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALK/CD246 Products

Research Areas for ALK/CD246 Recombinant Protein Antigen (NBP2-48518PEP)

Find related products by research area.

Blogs on ALK/CD246

There are no specific blogs for ALK/CD246, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ALK/CD246 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ALK