ALK-1 Antibody (8L2V7) Summary
| Description |
Novus Biologicals Rabbit ALK-1 Antibody (8L2V7) (NBP3-16876) is a recombinant monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 404-503 of human ALK-1 (P37023). VLWEIARRTIVNGIVEDYRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKISNSPEKPKVIQ |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
ACVRL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:1000
|
| Theoretical MW |
56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ALK-1 Antibody (8L2V7)
Background
LTK, ALK and Ros have been identified as receptor tyrosine kinases having sequence similarity to the insulin receptor subfamily of kinases. LTK (leukocyte tyrosine kinase) is expressed in murine B lymphocyte precursors and has also been found in forebrain neurons. ALK (anaplastic lymphoma kinase) is normally highly expressed, specifically in the nervous system. A truncated form containing the catalytic domian of ALK is expressed as the result of a translocation occurring in many non-Hodgkin's lymphomas. The c-Ros gene was originally identified in mutant form as an oncogene. Ros is normally expressed in a small number of epithelial cell types and may play a role in epithelial development.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Publications for ALK-1 Antibody (NBP3-16876) (0)
There are no publications for ALK-1 Antibody (NBP3-16876).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ALK-1 Antibody (NBP3-16876) (0)
There are no reviews for ALK-1 Antibody (NBP3-16876).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ALK-1 Antibody (NBP3-16876) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ALK-1 Products
Research Areas for ALK-1 Antibody (NBP3-16876)
Find related products by research area.
|
Blogs on ALK-1