ALG6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ALG6 Antibody [NBP2-56400] - Staining of human cell line SiHa shows localization to endoplasmic reticulum.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ALG6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FTEREQTLQVLRRLFPVDRGLFEDKVANIWCSFNVFLKIKDI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALG6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ALG6 Recombinant Protein Antigen (NBP2-56400PEP)

Reactivity Notes

Mouse 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ALG6 Antibody - BSA Free

• alpha-1,3-glucosyltransferase)
• asparagine-linked glycosylation 6 homolog (S. cerevisiae
• asparagine-linked glycosylation 6 homolog (yeast
• asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S.cerevisiae)
• Asparagine-linked glycosylation protein 6 homolog
• CDG1C
• dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase
• Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase
• dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase
• EC 2.4.1
• EC 2.4.1.-
• Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase

Background

ALG6, or Asparagine-Linked Glycosylation 6 Alpha-1 3-Glucosyltransferase Homolog, consists of a 507 amino acid isoform that is 58 kDa, and is involved in the addition of the first glucose residue and the transfer of glucose during N-linked glycosylation. Current research is being conducted on the relation of ALG6 and several disorders and diseases including protein-losing enteropathy, pseudotumor cerebri, and hypotonia. The protein interacts with ALG12, ALG3, ALG5, ALG8, and AP3D1 in several protein metabolism, biosynthesis, and modification pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALG6