ALG10 Antibody


Western Blot: ALG10 Antibody [NBP2-14281] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: ALG10 Antibody [NBP2-14281] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ALG10 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLP
Specificity of human ALG10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ALG10 Protein (NBP2-14281PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ALG10 Antibody

  • ALG10A
  • alpha-1,2-glucosyltransferase ALG10-A
  • alpha-1,2-glucosyltransferase)
  • Alpha-2-glucosyltransferase ALG10-A
  • alpha2-glucosyltransferase
  • asparagine-linked glycosylation 10 homolog (yeast
  • asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S.pombe)
  • asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog(yeast)
  • Asparagine-linked glycosylation protein 10 homolog A
  • derepression of ITR1 expression 2 homolog
  • DIE2
  • EC 2.4.1
  • EC 2.4.1.-
  • EC
  • FLJ14751
  • KCR1
  • potassium channel regulator 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Ma, Mk, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for ALG10 Antibody (NBP2-14281) (0)

There are no publications for ALG10 Antibody (NBP2-14281).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG10 Antibody (NBP2-14281) (0)

There are no reviews for ALG10 Antibody (NBP2-14281). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG10 Antibody (NBP2-14281) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ALG10 Products

ALG10 NBP2-14281

Bioinformatics Tool for ALG10 Antibody (NBP2-14281)

Discover related pathways, diseases and genes to ALG10 Antibody (NBP2-14281). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG10 Antibody (NBP2-14281)

Discover more about diseases related to ALG10 Antibody (NBP2-14281).

Pathways for ALG10 Antibody (NBP2-14281)

View related products by pathway.

PTMs for ALG10 Antibody (NBP2-14281)

Learn more about PTMs related to ALG10 Antibody (NBP2-14281).

Blogs on ALG10

There are no specific blogs for ALG10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ALG10 Antibody and receive a gift card or discount.


Gene Symbol ALG10