ALG2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ALG2 Antibody [NBP1-85715] - Staining of human cell line U-2 OS shows localization to cytosol & actin filaments. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ALG2 Antibody [NBP1-85715] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ALG2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALG2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ALG2 Protein (NBP1-85715PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ALG2 Antibody - BSA Free

• alpha-1,3-mannosyltransferase ALG2
• alpha-1,3-mannosyltransferase)
• asparagine-linked glycosylation 2 homolog (S. cerevisiae
• asparagine-linked glycosylation 2 homolog (yeast
• asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S.cerevisiae)
• Asparagine-linked glycosylation protein 2 homolog
• CDGIi
• EC 2.4.1
• EC 2.4.1.-
• FLJ14511
• GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase
• hALPG2
• homolog of yeast ALG2
• NET38

Background

ALG2 encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii). Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALG2