ALG2 Antibody

Images

 
Western Blot: ALG2 Antibody [NBP1-85715] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: ALG2 Antibody [NBP1-85715] - Staining of human cell line U-2 OS shows localization to cytosol & actin filaments.
Immunohistochemistry-Paraffin: ALG2 Antibody [NBP1-85715] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALG2 Protein (NBP1-85715PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALG2 Antibody

  • alpha-1,3-mannosyltransferase ALG2
  • alpha-1,3-mannosyltransferase)
  • asparagine-linked glycosylation 2 homolog (S. cerevisiae
  • asparagine-linked glycosylation 2 homolog (yeast
  • asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S.cerevisiae)
  • Asparagine-linked glycosylation protein 2 homolog
  • CDGIi
  • EC 2.4.1
  • EC 2.4.1.-
  • FLJ14511
  • GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase
  • hALPG2
  • homolog of yeast ALG2
  • NET38

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32539
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-05034
Species: Hu
Applications: WB, PEP-ELISA
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-62494
Species: Hu
Applications: WB
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91577
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76869
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-16215
Species: Hu
Applications: WB, ChIP, IP
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91658
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP1-85715
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ALG2 Antibody (NBP1-85715) (0)

There are no publications for ALG2 Antibody (NBP1-85715).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG2 Antibody (NBP1-85715) (0)

There are no reviews for ALG2 Antibody (NBP1-85715). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ALG2 Antibody (NBP1-85715) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALG2 Products

Bioinformatics Tool for ALG2 Antibody (NBP1-85715)

Discover related pathways, diseases and genes to ALG2 Antibody (NBP1-85715). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG2 Antibody (NBP1-85715)

Discover more about diseases related to ALG2 Antibody (NBP1-85715).
 

Pathways for ALG2 Antibody (NBP1-85715)

View related products by pathway.

PTMs for ALG2 Antibody (NBP1-85715)

Learn more about PTMs related to ALG2 Antibody (NBP1-85715).

Blogs on ALG2

There are no specific blogs for ALG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG2