Home » ALG2 » ALG2 Research Products » ALG2 Antibody

ALG2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ALG2 Antibody [NBP1-84569] - Analysis in control (vector only transfected HEK293T lysate) and ALG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: ALG2 Antibody [NBP1-84569] - Analysis in control (vector only transfected HEK293T lysate) and ALG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ALG2 Antibody [NBP1-84569] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ALG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTK
Specificity
Specificity of human ALG2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ALG2 Protein (NBP1-84569PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ALG2 Antibody

  • alpha-1,3-mannosyltransferase ALG2
  • alpha-1,3-mannosyltransferase)
  • asparagine-linked glycosylation 2 homolog (S. cerevisiae
  • asparagine-linked glycosylation 2 homolog (yeast
  • asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S.cerevisiae)
  • Asparagine-linked glycosylation protein 2 homolog
  • CDGIi
  • EC 2.4.1
  • EC 2.4.1.-
  • FLJ14511
  • GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase
  • hALPG2
  • homolog of yeast ALG2
  • NET38

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ALG1 Antibody
NBP2-32539
Immunocytochemistry/Immunofluorescence: ALG1 Antibody [NBP2-32539] - Staining of human cell line Hep G2 shows localization to nucleoli fibrillar center & endoplasmic reticulum.
Immunohistochemistry-Paraffin: ALG1 Antibody [NBP2-32539] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts, Leydig cells shows moderate staining.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DPAGT1 Antibody
NBP2-81923
Western Blot: DPAGT1 Antibody [NBP2-81923] - Analysis of DPAGT1 in mouse kidney tissue lysate with DPAGT1 antibody at 1 ug/ml in (A) the absence and (B) the presence of blocking peptide.
Immunocytochemistry/Immunofluorescence: DPAGT1 Antibody [NBP2-81923] - Analysis of DPAGT1 in human kidney tissue with DPAGT1 antibody at 20 ug/ml.
Immunohistochemistry: DPAGT1 Antibody [NBP2-81923] - Analysis of DPAGT1 in human kidney tissue with DPAGT1 antibody at 2.5 ug/ml.
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Image of Caspase-3 Antibody (31A1067) - (Pro and Active). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Immunohistochemistry-Paraffin: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Tissue section of human spleen using 1:200 dilution of Caspase-3 antibody (clone 31A1067). The staining was developed with HRP labeled anti-mouse IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Caspase 3 antibody generated primarily a specific cytoplasmic staining in a subset of spleenocytes with some nuclear signal in a few cells.
Simple Western: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Simple Western lane view shows a specific band for Caspase-3 Antibody (31A1067) - (Pro and Active) in 0.1 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system.
(1 Review)
(154 Publications)
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
DPM1 Antibody
NBP1-05034
Western Blot: DPM1 Antibody [NBP1-05034] - (0.1ug/ml) staining of Human Liver lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: DPM1 Antibody [NBP1-05034] - (3.75ug/ml) staining of paraffin embedded Human Tonsil. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
PDCD6 Antibody
NBP2-94061
Western Blot: PDCD6 Antibody [NBP2-94061] - Analysis of 200ug extracts of HepG2 cells, using PDCD6 at a dilition of 1:1000.
Immunocytochemistry/Immunofluorescence: PDCD6 Antibody [NBP2-94061] - Analysis of HeLa cells using PDCD6. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: PDCD6 Antibody [NBP2-94061] - Paraffin-embedded rat kidney using PDCD6.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
p23/PTGES3
Antibody (JJ3)
NB300-576
Western Blot: p23/PTGES3 Antibody (JJ3) [NB300-576] - Analysis of 25 ug of Hela (Lane 1), HepG2 (Lane 2), and mouse spleen cell lysates (Lane 3) and a molecular weight protein ladder.
Immunocytochemistry/Immunofluorescence: p23/PTGES3 Antibody (JJ3) [NB300-576] - p23 staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing p23 at a dilution of 1:500 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: p23/PTGES3 Antibody (JJ3) [NB300-576] - Normal biopsies of deparaffinized Human testis tissue.
(6 Publications)
Species: Hu, Mu, Rt, Ch, Gp, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
ALG6 Antibody
NBP1-62494
Western Blot: ALG6 Antibody [NBP1-62494] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: ALG6 Antibody [NBP1-62494] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: ALG6 Antibody [NBP1-62494] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Species: Hu
Applications: WB
GADD153/CHOP
Antibody (9C8)
NB600-1335
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - Ethanol feeding increases CHOP expression. Image from verified customer review.
Immunohistochemistry-Paraffin: GADD153/CHOP Antibody (9C8) [NB600-1335] - FFPE tissue section of mouse brain using 1:100 dilution of GADD153/CHOP antibody. The signal was developed using HRP-DAB based detection method which followed counterstaining of the nuclei with hematoxylin. The antibody generated a cytoplasmic and nuclear staining of CHOP in various cell types in the tested section.
Western Blot: GADD153/CHOP Antibody (9C8) [NB600-1335] - GADD153/CHOP expression in HeLa cells treated with 2.5 ug/mL tunicamycin for 4 hours (Lane 1) and untreated (Lane 2).
(3 Reviews)
(34 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, ChIP, KD
Myelin Protein
Zero Antibody
NB100-1607
Immunocytochemistry/Immunofluorescence: Myelin Protein Zero Antibody [NB100-1607] - Immunohistochemical staining of P-zero on a 4.0% paraformaldehyde-fixed, paraffin-embedded tissue section through the sciatic nerve of an adult mouse. (Green) P0 concentration was 1:1000 dilution, followed by fluorescein-labeled goat anti-chicken IgY (1:500 dilution). Red is actin. Blue is DAPI nuclear counterstain.
Immunohistochemistry: Myelin Protein Zero Antibody [NB100-1607] - In the image (a lower power tissue section through an adult sciatic nerve), Myelin Protein Zero (brown staining) can be seen in all of the myelinating Schwann cells.
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
ALG11 Antibody
NBP1-91577
Western Blot: ALG11 Antibody [NBP1-91577] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: ALG11 Antibody [NBP1-91577] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Species: Hu
Applications: WB, IHC, IHC-P
Recombinant Human
AGA Protein
NBP2-52631
SDS-Page: Recombinant Human AGA Protein [NBP2-52631]
(1 Publication)
Species: Hu
Acinus Antibody
NBP1-76869
Western Blot: Acinus Antibody [NBP1-76869] - Western Blot Validation in Human TissueLoading: 15 ug of lysates per lane.Antibodies: BIM NBP1-76869, (0.5 ug/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate.Lane 1: Human thymusLane 2: Human colon
Immunocytochemistry/Immunofluorescence: Acinus Antibody [NBP1-76869] - Staining of Acinus in K562 cells with Acinus antibody at 20 ug/ml.
Western Blot: Acinus Antibody [NBP1-76869] - K562 whole cell lysate with Acinus antibody (CP) at 1 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF
DP1 Antibody
NBP2-92865
Immunohistochemistry-Paraffin: DP1 Antibody [NBP2-92865] - Paraffin-embedded rat testis using DP1.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CRABP2 Antibody
NB100-2590
Western Blot: CRABP2 Antibody [NB100-2590] - Whole cell lysate (5, 15 and 50 ug) from MCF7 cells. Antibody used at 0.04 ug/ml.
Immunohistochemistry-Paraffin: CRABP2 Antibody [NB100-2590] - Section of human prostate carcinoma. Antibody: Affinity purified rabbit anti-CRABP2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
(2 Publications)
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
CDK4 Antibody
NBP1-31308
Western Blot: CDK4 Antibody [NBP1-31308] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with CDK4 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CDK4 Antibody [NBP1-31308] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: CDK4 protein stained by CDK4 antibody diluted at 1:500. Red: phalloidin, a cytoskeleton marker, diluted at 1:200. Scale bar = 10 um.
Immunohistochemistry-Paraffin: Cdk4 Antibody [NBP1-31308] - Paraffin-embedded Gastric ca, using antibody at 1:500 dilution.
(5 Publications)
Species: Hu, Mu, Rt, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-P
ALG3 Antibody
NBP1-91658
Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658] - Staining of human kidney shows distinct cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ALG3 Antibody [NBP1-91658] - Staining of human placenta shows moderate cytoplasmic postivity in trophoblastic cells.
Species: Hu
Applications: IHC, IHC-P
MPHOSPH6 Antibody
NBP2-19388
Western Blot: MPHOSPH6 Antibody [NBP2-19388] - Sample (30 ug of whole cell lysate) A: HCT116 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: MPHOSPH6 Antibody [NBP2-19388] - Analysis of paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: MPHOSPH6 Antibody [NBP2-19388] - Immunohistochemical analysis of paraffin-embedded MB157 xenograft, using antibody at 1:500 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ALG8 Antibody
NBP2-47550
Western Blot: ALG8 Antibody [NBP2-47550] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG.
Immunocytochemistry/Immunofluorescence: ALG8 Antibody [NBP2-47550] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALG8 Antibody [NBP2-47550] - Staining of human colon tissue. Shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TRAPPC9 Antibody
NB100-55735
TRAPPC9 Antibody
(1 Publication)
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
ALG2 Antibody
NBP1-84569
ALG2 Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ALG2 Antibody (NBP1-84569) (0)

There are no publications for ALG2 Antibody (NBP1-84569).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG2 Antibody (NBP1-84569) (0)

There are no reviews for ALG2 Antibody (NBP1-84569). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG2 Antibody (NBP1-84569) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ALG2 Products

Bioinformatics Tool for ALG2 Antibody (NBP1-84569)

Discover related pathways, diseases and genes to ALG2 Antibody (NBP1-84569). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG2 Antibody (NBP1-84569)

Discover more about diseases related to ALG2 Antibody (NBP1-84569).
 

Pathways for ALG2 Antibody (NBP1-84569)

View related products by pathway.

PTMs for ALG2 Antibody (NBP1-84569)

Learn more about PTMs related to ALG2 Antibody (NBP1-84569).

Blogs on ALG2

There are no specific blogs for ALG2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ALG2
Entrez
Uniprot