Aldo-keto Reductase 1C3/AKR1C3 Antibody

Images

 
Western Blot: Aldo-keto Reductase 1C3/AKR1C3 Antibody [H00008644-D01P] - Analysis of AKR1C3 expression in human colon.
Western Blot: Aldo-keto Reductase 1C3/AKR1C3 Antibody [H00008644-D01P] - Analysis of AKR1C3 expression in transfected 293T cell line by AKR1C3 polyclonal antibody.Lane 1: AKR1C3 transfected lysate(36.90 KDa).Lane 2: ...read more

Order Details


    • Catalog Number
      H00008644-D01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Aldo-keto Reductase 1C3/AKR1C3 Antibody Summary

Immunogen
AKR1C3 (NP_003730.4, 1 a.a. - 323 a.a.) full-length human protein. MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Specificity
Reacts with aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II).
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKR1C3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.
Publications
Read Publications using H00008644-D01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aldo-keto Reductase 1C3/AKR1C3 Antibody

  • 17-beta-hydroxysteroid dehydrogenase type 5
  • 3-alpha-HSD type 2
  • 3-alpha-hydroxysteroid dehydrogenase type 2
  • AKR1C3
  • Aldo-keto Reductase 1C3
  • aldo-keto reductase family 1 member C3
  • aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)
  • AldoketoReductase 1C3
  • Chlordecone reductase homolog HAKRb
  • DD3
  • DD-3
  • DD317-beta-HSD 5
  • DDH1
  • DDX
  • Dihydrodiol dehydrogenase 3
  • Dihydrodiol dehydrogenase type I
  • dihydrodiol dehydrogenase X
  • EC 1.1.1
  • EC 1.1.1.112,3-alpha-HSD type II, brain
  • EC 1.1.1.188
  • EC 1.1.1.213
  • EC 1.1.1.63
  • EC 1.1.1.64
  • EC 1.3.1.20
  • HA1753
  • HAKRB
  • HAKRBtype IIb 3-alpha hydroxysteroid dehydrogenase
  • HAKRe
  • HSD17B5
  • hydroxysteroid (17-beta) dehydrogenase 5
  • Indanol dehydrogenase
  • KIAA0119hluPGFS
  • PGFS
  • Prostaglandin F synthase
  • Testosterone 17-beta-dehydrogenase 5
  • Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase

Background

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-79775
Species: Hu
Applications: WB, IHC, IHC-P, PA
MAB6529
Species: Hu
Applications: WB, Simple Western
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90233
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-92824
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-75398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-62658
Species: Hu
Applications: WB, IHC, IHC-P
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, Gp, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P)(2)

Reviews for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P) (0)

There are no reviews for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Aldo-keto Reductase 1C3/AKR1C3 Products

Bioinformatics Tool for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P)

Discover related pathways, diseases and genes to Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P)

Discover more about diseases related to Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P).
 

Pathways for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P)

View related products by pathway.

PTMs for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P)

Learn more about PTMs related to Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P).
 

Research Areas for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P)

Find related products by research area.

Blogs on Aldo-keto Reductase 1C3/AKR1C3

There are no specific blogs for Aldo-keto Reductase 1C3/AKR1C3, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aldo-keto Reductase 1C3/AKR1C3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKR1C3
Entrez
Uniprot