Aldo-keto Reductase 1C3/AKR1C3 Antibody Summary
Immunogen |
AKR1C3 (NP_003730.4, 1 a.a. - 323 a.a.) full-length human protein. MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY |
Specificity |
Reacts with aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II). |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
AKR1C3 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
Quality control test: Antibody reactive against mammalian transfected lysate.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Aldo-keto Reductase 1C3/AKR1C3 Antibody
Background
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, IHC, IHC-P, PA
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Am, Ca, Gp, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Publications for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P)(2)
Showing Publications 1 -
2 of 2.
Reviews for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P) (0)
There are no reviews for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional Aldo-keto Reductase 1C3/AKR1C3 Products
Bioinformatics Tool for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P)
Discover related pathways, diseases and genes to Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P)
Discover more about diseases related to Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P).
| | Pathways for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P)
View related products by pathway.
|
PTMs for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P)
Learn more about PTMs related to Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P).
| | Research Areas for Aldo-keto Reductase 1C3/AKR1C3 Antibody (H00008644-D01P)
Find related products by research area.
|
Blogs on Aldo-keto Reductase 1C3/AKR1C3