Aldo-keto Reductase 1C1/AKR1C1 Antibody

Images

 
Western Blot: Aldo-keto Reductase 1C1/AKR1C1 Antibody [NBP1-68878] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: Aldo-keto Reductase 1C1/AKR1C1 Antibody [NBP1-68878] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aldo-keto Reductase 1C1/AKR1C1 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human AKR1C1. Peptide sequence: LERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATW
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKR1C1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against AKR1C1 and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Aldo-keto Reductase 1C1/AKR1C1 Antibody

  • 20 alpha-hydroxysteroid dehydrogenase
  • 20-ALPHA-HSD
  • 20-alpha-hydroxysteroid dehydrogenase
  • 2-ALPHA-HSD
  • AKR1C1
  • Aldo-keto Reductase 1C1
  • aldo-keto reductase family 1 member C1
  • aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha(3-alpha)-hydroxysteroid dehydrogenase)
  • AldoketoReductase 1C1
  • C9
  • Chlordecone reductase homolog HAKRC
  • DD1/DD2
  • DD1MGC8954
  • DDH1
  • DDHH-37
  • dihydrodiol dehydrogenase 1
  • Dihydrodiol dehydrogenase 1/2
  • dihydrodiol dehydrogenase isoform DD1
  • EC 1.1.1
  • EC 1.1.1.-
  • EC 1.1.1.112
  • EC 1.1.1.149,2-ALPHA-HSD
  • EC 1.3.1.20
  • HAKRC
  • HAKRCDDH1aldo-keto reductase C
  • HBAB
  • hepatic dihydrodiol dehydrogenase
  • High-affinity hepatic bile acid-binding protein
  • Indanol dehydrogenase
  • MBAB
  • Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
  • type II 3-alpha-hydroxysteroid dehydrogenase

Background

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-63270
Species: Hu
Applications: WB, ELISA
NBL1-09016
Species: Hu
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
AF1936
Species: Hu
Applications: WB, IP
H00001646-M03
Species: Hu
Applications: WB, ELISA
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP2-31752
Species: Hu
Applications: IHC, IHC-P
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00000712-P01
Species: Hu
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP1-68878
Species: Hu
Applications: WB, IHC

Publications for Aldo-keto Reductase 1C1/AKR1C1 Antibody (NBP1-68878) (0)

There are no publications for Aldo-keto Reductase 1C1/AKR1C1 Antibody (NBP1-68878).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aldo-keto Reductase 1C1/AKR1C1 Antibody (NBP1-68878) (0)

There are no reviews for Aldo-keto Reductase 1C1/AKR1C1 Antibody (NBP1-68878). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aldo-keto Reductase 1C1/AKR1C1 Antibody (NBP1-68878) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aldo-keto Reductase 1C1/AKR1C1 Products

Bioinformatics Tool for Aldo-keto Reductase 1C1/AKR1C1 Antibody (NBP1-68878)

Discover related pathways, diseases and genes to Aldo-keto Reductase 1C1/AKR1C1 Antibody (NBP1-68878). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aldo-keto Reductase 1C1/AKR1C1 Antibody (NBP1-68878)

Discover more about diseases related to Aldo-keto Reductase 1C1/AKR1C1 Antibody (NBP1-68878).
 

Pathways for Aldo-keto Reductase 1C1/AKR1C1 Antibody (NBP1-68878)

View related products by pathway.

PTMs for Aldo-keto Reductase 1C1/AKR1C1 Antibody (NBP1-68878)

Learn more about PTMs related to Aldo-keto Reductase 1C1/AKR1C1 Antibody (NBP1-68878).

Blogs on Aldo-keto Reductase 1C1/AKR1C1

There are no specific blogs for Aldo-keto Reductase 1C1/AKR1C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aldo-keto Reductase 1C1/AKR1C1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKR1C1
Entrez
Uniprot