ALDH18A1 Recombinant Protein Antigen

Images

 
There are currently no images for ALDH18A1 Protein (NBP1-83324PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ALDH18A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALDH18A1.

Source: E.coli

Amino Acid Sequence: SVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALDH18A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83324.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ALDH18A1 Recombinant Protein Antigen

  • aldehyde dehydrogenase 18 family, member A1
  • Aldehyde dehydrogenase family 18 member A1
  • delta-1-pyrroline-5-carboxylate synthase
  • EC 2.1.2.11
  • EC 2.3.3.13
  • GSASdelta1-pyrroline-5-carboxlate synthetase
  • MGC117316
  • P5CSdelta-1-pyrroline-5-carboxylate synthetase
  • PYCSEC 1.2.1.41
  • pyrroline-5-carboxylate synthetase (glutamate gamma-semialdehyde synthetase)

Background

ALDH18A1, or Delta-1-pyrroline-5-carboxylate synthase, contains a long 88 kDa and a short 87 kDa isoform, and is involved in the catalytic conversion of glutamate to glutamate 5-semialdehyde. Current research on ALDH18A1 is being conducted to determine the relation between the protein and a variety of diseases and disorders, including neurodegeneration, pneumonia, connective tissue disease, mental retardation, hypoornithinemia, tuberculosis, microcephaly, Alzheimer's disease, gastroesophageal reflux disease, and dementia. The protein has been linked to biosynthesis and metabolic pathways where it interacts with PUS1, UQCRFS1, ICT1, OAT, and MYC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005831-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-83239
Species: Bv, Hu
Applications: IHC, IHC-P, WB
NBP1-87308
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-2832
Species: Hu
Applications: ELISA, IHC, IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
H00008659-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NBP2-93699
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-52477
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-16661
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NBP3-05584
Species: Mu, Rt
Applications: WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
NBP1-83324PEP
Species: Hu
Applications: AC

Publications for ALDH18A1 Protein (NBP1-83324PEP) (0)

There are no publications for ALDH18A1 Protein (NBP1-83324PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH18A1 Protein (NBP1-83324PEP) (0)

There are no reviews for ALDH18A1 Protein (NBP1-83324PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ALDH18A1 Protein (NBP1-83324PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALDH18A1 Products

Bioinformatics Tool for ALDH18A1 Protein (NBP1-83324PEP)

Discover related pathways, diseases and genes to ALDH18A1 Protein (NBP1-83324PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH18A1 Protein (NBP1-83324PEP)

Discover more about diseases related to ALDH18A1 Protein (NBP1-83324PEP).
 

Pathways for ALDH18A1 Protein (NBP1-83324PEP)

View related products by pathway.

Research Areas for ALDH18A1 Protein (NBP1-83324PEP)

Find related products by research area.

Blogs on ALDH18A1

There are no specific blogs for ALDH18A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ALDH18A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH18A1