Home » ALDH18A1 » ALDH18A1 Proteins » ALDH18A1 Recombinant Protein Antigen

ALDH18A1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ALDH18A1 Protein (NBP1-83324PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

ALDH18A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALDH18A1.

Source: E.coli

Amino Acid Sequence: SVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRD
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALDH18A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83324.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ALDH18A1 Recombinant Protein Antigen

  • aldehyde dehydrogenase 18 family, member A1
  • Aldehyde dehydrogenase family 18 member A1
  • delta-1-pyrroline-5-carboxylate synthase
  • EC 2.1.2.11
  • EC 2.3.3.13
  • GSASdelta1-pyrroline-5-carboxlate synthetase
  • MGC117316
  • P5CSdelta-1-pyrroline-5-carboxylate synthetase
  • PYCSEC 1.2.1.41
  • pyrroline-5-carboxylate synthetase (glutamate gamma-semialdehyde synthetase)

Background

ALDH18A1, or Delta-1-pyrroline-5-carboxylate synthase, contains a long 88 kDa and a short 87 kDa isoform, and is involved in the catalytic conversion of glutamate to glutamate 5-semialdehyde. Current research on ALDH18A1 is being conducted to determine the relation between the protein and a variety of diseases and disorders, including neurodegeneration, pneumonia, connective tissue disease, mental retardation, hypoornithinemia, tuberculosis, microcephaly, Alzheimer's disease, gastroesophageal reflux disease, and dementia. The protein has been linked to biosynthesis and metabolic pathways where it interacts with PUS1, UQCRFS1, ICT1, OAT, and MYC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PYCR1 Antibody
H00005831-B01P
Western Blot: PYCR1 Antibody [H00005831-B01P] - Pig liver extracts. Lane 1: 30 ug, Lane 2: 45 ug, Lane 3: 60 ug, Lane 4: secondary anti-mouse antibody only. Image from verified customer review.
Western Blot: PYCR1 Antibody [H00005831-B01P] - Expression in U-2 OS.
Immunocytochemistry/Immunofluorescence: PYCR1 Antibody [H00005831-B01P] - Analysis of purified antibody to PYCR1 on HeLa cell (antibody concentration 10 ug/mL).
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
OAT Antibody
NBP1-83239
Western Blot: OAT Antibody [NBP1-83239] - Analysis in control (vector only transfected HEK293T lysate) and OAT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Analysis in human duodenum and pancreas tissues. Corresponding OAT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: OAT Antibody [NBP1-83239] - Staining of human cerebral cortex shows moderate to strong granular cytoplasmic positivity in neurons.
(2 Reviews)
Species: Bv, Hu
Applications: IHC, IHC-P, WB
Pyruvate
Dehydrogenase Phospha ...
NBP1-87308
Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Western Blot: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Analysis in human cell lines SK-MEL-30 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Western Blot: Pyruvate Dehydrogenase Phosphatase/PDP1/PPM2C Antibody [NBP1-87308] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NB110-41404] - Immunofluorescence using NB110-41404. Submitted via verified customer review.
Western Blot: Glutamine Synthetase Antibody [NB110-41404] - Analysis of glutamine synthase. 40ug of lysates from mouse (Lanes M), rat (Lane R), pig (Lane P), bovine (Lane B), or human (Lane Hu) retina were probed. A 42 kDa band was identified in lysates from retinas of all species.
Immunohistochemistry: Glutamine Synthetase Antibody [NB110-41404] - Localization of glutamine synthase in the retina. Paraffin sections of mouse (A, B), rat (C, D, G-I), or human (E, F) retina fixed in 4% paraformaldehyde were reacted with anti-glutamine synthase (red fluorescence staining in B, D, G, I, and brown immuno-peroxidase reaction. Nuclei in IF experiments (A-D) were stained with DAPI (cyan), and with nuclear fast red in E and F. At low magnification, anti-glutamine synthase reacted with a single population of cells extending from the ganglion cell layer through the inner nuclear layer. No signal was detected in controls either pre-incubated with 100ug/ml of the immunizing peptide (A) or with pre-immune serum (C, E). This finding was confirmed by co-localization (indicated by yellow in I) of glutamine synthase (red in G) with antoher marker of glutamine synthase (green in H).
(1 Review)
(6 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
PRODH Antibody
NB100-2832
PRODH Antibody [NB100-2832] - (6ug/ml) staining of paraffin embedded Human Kidney. Heat induced antigen retrieval with citrate buffer pH 6, HRP-staining.
Immunohistochemistry: PRODH Antibody [NB100-2832] - Control showing staining of paraffin embedded Human Kidney, with no primary antibody
(1 Publication)
Species: Hu
Applications: ELISA, IHC, IHC-P
Catalase Antibody
[Unconjugated]
AF3398
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, andRat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti‑Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2. 
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and Raji human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Catalase at approximately 62 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Catalase knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Catalase at approximately 64 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
ALDH4A1 Antibody
(1A12-A5)
H00008659-M01
Western Blot: ALDH4A1 Antibody (1A12-A5) [H00008659-M01] - ALDH4A1 expression in Hela ( Cat # L013V1 ).
Immunohistochemistry-Paraffin: ALDH4A1 Antibody (1A12-A5) [H00008659-M01] - Analysis of monoclonal antibody to ALDH4A1 on formalin-fixed paraffin-embedded human liver tissue.Antibody concentration 5 ug/ml.
Sandwich ELISA: ALDH4A1 Antibody (1A12-A5) [H00008659-M01] - Detection limit for recombinant GST tagged ALDH4A1 is approximately 0.1ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
APE Antibody
(13B8E5C2) - BSA Free
NB100-116
Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-APE (13B8E5C2) at 5 ug/mL overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Chromatin Immunoprecipitation (ChIP): APE Antibody (13B8E5C2) [NB100-116] - Association of p53 and APE1 on p53-binding sites in p21 promoter. Re-ChIP analysis (first IP with alpha-APE1 and the second IP with alpha-p53 antibody) showing simultaneous recruitment of APE1 and p53 in control vs. EPE treated cells; *: p value <0.05 (n=2) calculated based on APE1/p53 enriched DNA from control vs. etoposide treated cells. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0068467) licensed under a CC-BY licence.
(3 Reviews)
(102 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
SLC7A2 Antibody
NBP2-93699
Immunohistochemistry-Paraffin: SLC7A2 Antibody [NBP2-93699] - Human mammary cancer using SLC7A2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SLC7A2 Antibody [NBP2-93699] - Human placenta using SLC7A2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SLC7A2 Antibody [NBP2-93699] - Mouse testis using SLC7A2 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.
Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(13 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
G protein alpha
Antibody (2A2B7) - BS ...
NBP2-52477
ELISA: G protein alpha Antibody (2A2B7) [NBP2-52477] - Black line: Control Antigen (100 ng); Purple line: Antigen(10ng); Blue line: Antigen (50 ng); Red line: Antigen (100 ng);
Flow Cytometry: G protein alpha Antibody (2A2B7) [NBP2-52477] - Analysis of A549 cells using GNAS mouse mAb (green) and negative control (red).
Immunohistochemistry: G protein alpha Antibody (2A2B7) [NBP2-52477] - Analysis of paraffin-embedded lung cancer tissues using GNAS mouse mAb with DAB staining.
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
GIT2 Antibody
NBP2-16661
Immunohistochemistry-Frozen: GIT2 Antibody [NBP2-16661] - GIT2 antibody detects GIT2 protein expression by immunohistochemical analysis.Sample: Frozen-sectioned adult mouse cerebellum. Green: GIT2 protein stained by GIT2 antibody diluted at 1:250. Red: NF-H, stained by NF-H antibody diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunocytochemistry/Immunofluorescence: GIT2 Antibody [NBP2-16661] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: GIT2 protein stained by GIT2 antibody [N1N3] diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Western Blot: GIT2 Antibody [NBP2-16661] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with GIT2 antibody [N1N3] diluted at 1:1000.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, WB
GAPDH Antibody
(1D4)
NB300-221
Western Blot: GAPDH Antibody (1D4) [NB300-221] - Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - Analysis of of HeLa cells stained with GAPDH antibody, dilution 1:100 (Green). DAPI staining of nuclear DNA (Blue). The GAPDHantibody produces strong cytoplasmic staining of healthy cells.
Immunocytochemistry/Immunofluorescence: GAPDH Antibody (1D4) [NB300-221] - SH-SY5Y cells stained with GAPDH antibody NB300-221 (green). Nuclear DNA is stained with Hoechst dye (blue).
(19 Reviews)
(366 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
PRB4 Antibody
NBP3-05584
Western Blot: PRB4 Antibody [NBP3-05584] - Western blot analysis of extracts of various cell lines, using PRB4 antibody (NBP3-05584) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Species: Mu, Rt
Applications: WB
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded breast tissue using anti-PMEL17/SILV mouse monoclonal antibody.
(1 Review)
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
csl/RBPJK Antibody
NBP1-33427
Chromatin Immunoprecipitation (ChIP): csl/RBPJK Antibody [NBP1-33427] - Sheared, cross-linked chromatin was prepared from Jurkat T-ALL cells using the Covaris TruChIP kit and shearing with the LE220 sonicator. The chromatin buffer was adjusted to 150 mM NaCl, 20 mM Tris-Cl pH 8, 2 mM EDTA, and 1% Triton X-100. Three antibodies, as well as pure pre-immune rabbit IgG control, were added to each IP reaction, consisting of 7 million cells, and incubated overnight with mixing at 4 C. The antibodies were captured with Magna ChIP Protein A+G beads (Millipore), washed with three wash buffers, and the DNA eluted and purified with the iPure v2 kit (Diagenode). The purified DNA was normalized to the input control with qPCR quantification of the insulin exon 1 gene (INS) and an RBPJ binding site in the promoter of HES1. Image from verified customer review.
Western Blot: csl/RBPJK Antibody [NBP1-33427] - Sample (30 ug of whole cell lysate) A: Jurkat 7.5% SDS PAGE diluted at 1:2000
Immunocytochemistry/Immunofluorescence: csl/RBPJK Antibody [NBP1-33427] - Analysis of paraformaldehyde-fixed HeLa at 1:100 dilution.
(1 Review)
Species: Hu
Applications: ChIP, ICC/IF, WB
ALDH18A1
Recombinant Protein A
NBP1-83324PEP
ALDH18A1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ALDH18A1 Protein (NBP1-83324PEP) (0)

There are no publications for ALDH18A1 Protein (NBP1-83324PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH18A1 Protein (NBP1-83324PEP) (0)

There are no reviews for ALDH18A1 Protein (NBP1-83324PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ALDH18A1 Protein (NBP1-83324PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALDH18A1 Products

Bioinformatics Tool for ALDH18A1 Protein (NBP1-83324PEP)

Discover related pathways, diseases and genes to ALDH18A1 Protein (NBP1-83324PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH18A1 Protein (NBP1-83324PEP)

Discover more about diseases related to ALDH18A1 Protein (NBP1-83324PEP).
 

Pathways for ALDH18A1 Protein (NBP1-83324PEP)

View related products by pathway.

Research Areas for ALDH18A1 Protein (NBP1-83324PEP)

Find related products by research area.

Blogs on ALDH18A1

There are no specific blogs for ALDH18A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: GAPDH Antibody (1D4) [NB300-221] - Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
GAPDH Antibody (1D4)
NB300-221
Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-APE (13B8E5C2) at 5 ug/mL overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
APE Antibody (13B8E5C2) - BSA Free
NB100-116

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ALDH18A1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ALDH18A1