alcohol dehydrogenase 6 Antibody (4G4)

Images

 
Western Blot: alcohol dehydrogenase 6 Antibody (4G4) [H00000130-M01] - ADH6 monoclonal antibody (M01), clone 4G4 Analysis of ADH6 expression in K-562.
ELISA: alcohol dehydrogenase 6 Antibody (4G4) [H00000130-M01] - Detection limit for recombinant GST tagged ADH6 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

alcohol dehydrogenase 6 Antibody (4G4) Summary

Immunogen
ADH6 (NP_000663, 55 a.a. ~ 144 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSKHLDLLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSKTQLMSDGTSRFTCKGKSIYHFGNT
Specificity
ADH6 - alcohol dehydrogenase 6 (class V)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ADH6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for alcohol dehydrogenase 6 Antibody (4G4)

  • ADH-5
  • alcohol dehydrogenase 6 (class V)
  • alcohol dehydrogenase 6
  • aldehyde reductase
  • EC 1.1.1
  • EC 1.1.1.1

Background

This gene encodes class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This gene is expressed in the stomach as well as in the liver, and it contains a glucocorticoid response element upstream of its 5' UTR, which is a steroid hormone receptor binding site. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
DY262
Species: Hu
Applications: ELISA
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87416
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00057016-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB100-1162
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-02192
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-48531
Species: Hu
Applications: IHC, IHC-P
NBP2-95141
Species: Mu, Rt
Applications: IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-32828
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
H00000130-M01
Species: Hu
Applications: WB, ELISA

Publications for alcohol dehydrogenase 6 Antibody (H00000130-M01) (0)

There are no publications for alcohol dehydrogenase 6 Antibody (H00000130-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 6 Antibody (H00000130-M01) (0)

There are no reviews for alcohol dehydrogenase 6 Antibody (H00000130-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alcohol dehydrogenase 6 Antibody (H00000130-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alcohol dehydrogenase 6 Products

Bioinformatics Tool for alcohol dehydrogenase 6 Antibody (H00000130-M01)

Discover related pathways, diseases and genes to alcohol dehydrogenase 6 Antibody (H00000130-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase 6 Antibody (H00000130-M01)

Discover more about diseases related to alcohol dehydrogenase 6 Antibody (H00000130-M01).
 

Pathways for alcohol dehydrogenase 6 Antibody (H00000130-M01)

View related products by pathway.

PTMs for alcohol dehydrogenase 6 Antibody (H00000130-M01)

Learn more about PTMs related to alcohol dehydrogenase 6 Antibody (H00000130-M01).
 

Research Areas for alcohol dehydrogenase 6 Antibody (H00000130-M01)

Find related products by research area.

Blogs on alcohol dehydrogenase 6

There are no specific blogs for alcohol dehydrogenase 6, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alcohol dehydrogenase 6 Antibody (4G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ADH6
Entrez
OMIM
Uniprot