alcohol dehydrogenase 1B Antibody

Images

 
Western Blot: alcohol dehydrogenase 1B Antibody [NBP2-86573] - WB Suggested Anti-ADH1B Antibody Titration: 1.25ug/ml. Positive Control: Jurkat cell lysate
Immunohistochemistry-Paraffin: alcohol dehydrogenase 1B Antibody [NBP2-86573] - Rabbit Anti-ADH1B Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alcohol dehydrogenase 1B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human alcohol dehydrogenase 1B. Peptide sequence: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ADH1B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for alcohol dehydrogenase 1B Antibody

  • ADH, beta subunit
  • ADH2alcohol dehydrogenase 1B
  • alcohol dehydrogenase 1B (class I), beta polypeptide
  • alcohol dehydrogenase 2 (class I), beta polypeptide
  • Alcohol dehydrogenase subunit beta
  • aldehyde reductase
  • DKFZp686C06125
  • EC 1.1.1
  • EC 1.1.1.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF009
Species: Hu
Applications: WB, IHC
NBP2-92824
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-1162
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29487
Species: Hu, Mu, Ha, Pm, Pm, Rb
Applications: IHC, IHC-P, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt, V-Vi
Applications: WB, IHC, IHC-P

Publications for alcohol dehydrogenase 1B Antibody (NBP2-86573) (0)

There are no publications for alcohol dehydrogenase 1B Antibody (NBP2-86573).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alcohol dehydrogenase 1B Antibody (NBP2-86573) (0)

There are no reviews for alcohol dehydrogenase 1B Antibody (NBP2-86573). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alcohol dehydrogenase 1B Antibody (NBP2-86573) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional alcohol dehydrogenase 1B Products

Bioinformatics Tool for alcohol dehydrogenase 1B Antibody (NBP2-86573)

Discover related pathways, diseases and genes to alcohol dehydrogenase 1B Antibody (NBP2-86573). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase 1B Antibody (NBP2-86573)

Discover more about diseases related to alcohol dehydrogenase 1B Antibody (NBP2-86573).
 

Pathways for alcohol dehydrogenase 1B Antibody (NBP2-86573)

View related products by pathway.

PTMs for alcohol dehydrogenase 1B Antibody (NBP2-86573)

Learn more about PTMs related to alcohol dehydrogenase 1B Antibody (NBP2-86573).
 

Research Areas for alcohol dehydrogenase 1B Antibody (NBP2-86573)

Find related products by research area.

Blogs on alcohol dehydrogenase 1B

There are no specific blogs for alcohol dehydrogenase 1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alcohol dehydrogenase 1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADH1B