ALAS2 Antibody (4D8)

Images

 
Western Blot: ALAS2 Antibody (4D8) [H00000212-M02] - ALAS2 monoclonal antibody (M02), clone 4D8. Western Blot analysis of ALAS2 expression in Raw 264.7 ( Cat # L024V1 ).
ELISA: ALAS2 Antibody (4D8) [H00000212-M02] - Detection limit for recombinant GST tagged ALAS2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
4D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ALAS2 Antibody (4D8) Summary

Immunogen
ALAS2 (NP_000023, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK
Specificity
ALAS2 - aminolevulinate, delta-, synthase 2 (sideroblastic/hypochromic anemia) (4D8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ALAS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ALAS2 Antibody (4D8)

  • 5-aminolevulinic acid synthase 2,5-aminolevulinate synthase, erythroid-specific, mitochondrial
  • ALASE
  • ALAS-E
  • aminolevulinate, delta-, synthase 2 (sideroblastic/hypochromic anemia)
  • aminolevulinate, delta-, synthase 2
  • ANH1
  • ASBXLDPP
  • Delta-ALA synthase 2
  • delta-ALA synthetase
  • Delta-aminolevulinate synthase 2
  • EC 2.3.1.37
  • FLJ93603
  • XLSA

Background

The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4415
Species: Hu
Applications: WB, ICC
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56415
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-89313
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2485
Species: Hu
Applications: WB, IHC, IP
NBP1-89897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-89158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00000212-M02
Species: Hu, Mu
Applications: WB, ELISA

Publications for ALAS2 Antibody (H00000212-M02) (0)

There are no publications for ALAS2 Antibody (H00000212-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALAS2 Antibody (H00000212-M02) (0)

There are no reviews for ALAS2 Antibody (H00000212-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALAS2 Antibody (H00000212-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALAS2 Products

Bioinformatics Tool for ALAS2 Antibody (H00000212-M02)

Discover related pathways, diseases and genes to ALAS2 Antibody (H00000212-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALAS2 Antibody (H00000212-M02)

Discover more about diseases related to ALAS2 Antibody (H00000212-M02).
 

Pathways for ALAS2 Antibody (H00000212-M02)

View related products by pathway.

PTMs for ALAS2 Antibody (H00000212-M02)

Learn more about PTMs related to ALAS2 Antibody (H00000212-M02).

Blogs on ALAS2

There are no specific blogs for ALAS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALAS2 Antibody (4D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol ALAS2
Entrez
Uniprot